dovetail fishing-🎖️togel88 alternatif|XOXE88.COM

SeleksiPPPK2022memberikankesempatanpelamarumumdalamseleksiPPPK2022.GurululusPGposisinyabagaimana?IlustrasiFoto:Ricardo/JPNN.comjpnn.com,JAKARTA-Rekrutmencalonaparatursipilnegara(CASN)akandigelarkembalitahunini.DataKementerianPendayagunaanAparaturNegaradanReformasi(KemenPAN-RB)menyebutkankuotaCASN2022sebanyak1.086.128.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Darijumlahtersebutkuotauntukpegawaipemerintahdenganperjanjiankerja(PPPK)instansipusatdandaerahsebanyak1.035.811.PengurusforumGuruLulusPassindovetail fishinggGradePegawaiPemerintahdenganPerjanjianKerja(GLPGPPPK)DKIJakartaHerlinamengungkapkansesuaiinformasidariDinasPendidikan,seleksiPPPK2022dibukajugauntukpelamarumum.Kuotayangdisiapkanpuncukupbanyak.BacaJuga:JelangTahunPolitik,WamenagZainutPeringatkanPNSdanPPPKPelamarumuminikataHerlina,semuaguruyangterdaftardidatapokokkependidikan(dapodik)kurangdari3tahun.Parapelamarumumharusmengikutites,tetapibagipesertabesertifikatpendidikmendapatkanafirmasikompetensiteknissebesar100persen.Untukpesertadisabilitasafirmasinya10persen,tuturHerlinakepadaJPNN.com,baru-baruini.HerlinamelanjutkansesuaipenjelasanDinasPendidikan,bagipelamaryangmasihbujangandanlulustes,akanditempatkandisekolahwilayah3T.BacaJuga:DataHonorerK2SudahValid,ButuhRegulasiPengangkatanjadiPNS&PPPKTersedia17ribukuotauntukpelamarlajangdanyangdiutamakanfreshgraduate.DalamPeraturanMenteriPendayagunaanAparaturNegaradanReformasiBirokrasi(PermenPAN-RB)Nomor20Tahun2022tentangPengadaanPPPKGurudiInstansiDaerahtahun2022,Pasal5disebutkanP1(prioritassatu)adalahgurunegeridanswastaluluspassinggradeyangmasihmengajarataupuntidak.

Priamengalamimasalahejakulasidini(Ilustrasi).Foto:Ricardo/JPNN.comjpnn.com-Ejakulasidinimerupakanproseskeluarnyaspermayangterjadilebihcepatdariyangdiharapkansaatberhubunganseksual.Priadianggapmengalamiejakulasidinibilasetelahsatumenitpenetrasi,tidakbisamenundaejakulasisaatberhubunganseksual,danmerasafrustrasiatautertekansehinggarelatifmenghindarikeintimanseksual.Janganabaikankondisiejakulasidini,karenabisamengganggukelancaranhubunganintim.Sebagailangkahawal,cobalakukancaramengatasiejakulasidinisendiriberikutini:BacaJuga:BanyakPriaMudaMengeluhSudahEjakulasiDini,DokterBoykeBeriKiatBegini1.KomunikasikandenganPasanganSaatadamasalahejakulasidini,pasanganbisaterkenadampak.Tidakjarangiamenjadibingung,kesal,tidakpuas,dansebagainya.Komunikasikanlahmasalahejakulasidinidenganpasangan.Denganbegitu,masalahinidiharapkandapatbisasegerateratasidankeintimantetapterjaga.Seringkali,salahsatupenyebabejakulasidiniadalahmasalahdenganpasangan.Jikamasalahdapatdiselesaikan,diharapkanperformaseksualpunmembaik.BacaJuga:BeginiSudutPandangIslamTentangOnanidanCaraMengatasinya2.LakukanMasturbasiKemudian,caramengatasiejakulasidinisendiridirumahsecaraalamiadalahmasturbasi.Cobamasturbasi1-2jamsebelumberhubunganseksualdenganpasangan.3.LatihanSenamKegelAgartidakcepatkeluarsaatberhubungan,lakukansenamKegelsebagaicarauntukmengatasinya.PengacaraHotmanParismenyebutmasadepanBharadaEditentukansekarang.Foto:Romaida/JPNN.comjpnn.com,JAKARTA-PengacaraHotmanParismenyinggungsoalmasadepanBharadaE,tersangkatewasnyaBrigadirJ.HaltersebutberkaitandenganstatusBharadaEsebagaisaksikuncidalamkasuskematianBrigadirJ.Menudovetail fishingrutHotmanParis,keterangandanpengakuandariBharadaEsangatlahpentingdalammengungkapkasusitu.BacaJuga:SiapaTersangkaBaruKasusBrigadirJ?HotmanParis:MungkinIrjenatauBrigjenPolisiMasadepanmuditentukansekaranginikarenakalaukamubuatpengakuansejujurnyamakapenyidikakanterbantuuntukmengungkapkanfaktasebenarnya,ujarHotmanmelaluiakunnyadiInstagramdikutippadaSelasa(9/8).PengacarabergayaparlenteitumengingatkanbebanyangharusditanggungBharadaEjikatakmengungkapkasussecarakeseluruhan.Lagi-lagi,rivalRazmanNasutionitumenyinggungsoalmasadepan.BacaJuga:HotmanParis:BharadaE,SayaPunyaIndraKeenam,Segeralah...Ingat,kalaubebannyahanyadikamu,bayangkanberatnyahukumandanmasadepanmumasihpanjangadikku,ucapHotmanParis.Olehkarenaitu,diamengimbauagarBharadaEbisamembuatpengakuanjujurdanmengungkapaktor-aktordibalikkasuskematianBrigadirJ.

dovetail fishing-🎖️togel88 alternatif|XOXE88.COM

RumahpribadiFerdySamboyangtertutuprapatsaatPutriCandrawathimenjalanipemeriksaanolehLembagaPerlindunganSaksidanKorban(LPSK)diJalanSagulingIII,DurenTiga,Pancoran,JakartaSelatan,Selasa(9/8).Foto:KennyKurniaPutra/JPNN.comjpnn.com,JAKARTA-IstriIrjenFerdySambo,PutriCandrawathimenjalaniassessmentpsikologisolehLembagaPerlindunganSaksidanKorban(LPSK),Selasa(9/8).googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});PemeriksaandilakukandikediamanpribadiIrjenFerdySamboyangberadadiJalanSagulingIII,DurenTiga,Pancoran,JakartaSelatan.DaripantauanJPNN.com,timLPSKtibadirumahpribadiFerdySambosekitarpukul10.20WIBmenaikimobilToyotaFortuner.BacaJuga:HotmanParis:Halo,BharadaE,KamuBisaSajaMerasaNyamandiTingkatPenyidikan,tetapiSekitar4orangdaritimLPSKlangsungmemasukirumahpribadiFerdySambo.RumahFerdySambosendiridikawalketatolehbeberapaorangyangmengenakanpakaiansipil.Sudahya,enggakenakdenganwarga(sekitar).Sayalelahmenjaga,menguruskaliansemua,katasalahsatuorangdenganpakaianpremankepadaawakmedia.BacaJuga:5PengakuanTerbaruBharadaE,ArahnyaSudahJelas,HariIniJenderalSigitUmumkanAktorPentingAwakmediayangberadadidepanrumahFerdySambotidakdiperbolehkanuntukmenunggudidepanrumahberlantai3itu.LPSKakanmemintaketeranganPutriCandrawathi,istrimantanKadivProvamPolriIrjenFerdySambo.KapolriJenderalListyoSigitPrabowomengumumkanIrjenFerdySambotersangkakasuspembunuhanBrigadirJ,diMabesPolri,Jakarta,Selasa(9/8).Foto:Ricardo/JPNNjpnn.com,JAKARTA-PemilikpistolyangdipakaiBhayangkaraDuaRichardEliezeraliasBharadaEmenembakNofryansahYosuaHutabarataliasBrigadirJterungkap.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});BrigadirJtewasdirumahdinasmantanKadivPropamPolriIrjenFerdySambo,KompleksDurenTiga,JakartaSelatanpadaJumat(8/7)lalu.KapolriJenderalListyoSigitPrabowomenyebutkanBharadaEmenembakBrigadirJatasperintahFerdySambo.BacaJuga:AnalisisRezaIndragiri:AdaPerbuatanBerulangDialamiPutriCandrawathi,BeginiSenakaapi(senpi)yangdipakaiBharadaEmenembakrekannyasesamaajudankadivpropamitumerupakanmilikBrigadirRickyRizalalisBrigadirRR.BrigadirRRjugatelahditetapkansebagaitersangkadalamkasuspembunuhanitu.PenembakanterhadapBrigadirJdilakukanatasperintahSaudaraFSdenganmenggunakansenjatamilikSaudaraBrigadirR,kataJenderalListyodiBareskrimPolri,Selasa(9/8).BacaJuga:IniPeranFerdySamboCsdiKasusPenembakanBrigadirJKendatidemikian,belumdiketahuiapakahIrjenFerdySambojugaikutmenembakkorban.TerkaitapakahFSikuttembak(menembakBrigadirJ,red),inisedangdilakukanpendalaman,ucapmantanKabareskrimPolriitu.TangkapanlayarMenteriKesehatanMalaysiaKhairyJamaluddinsaatmemberikanketeranganpersterkaitsituasikasusCOVID-19diMalaysiasecaradaringdiaksesdariKualaLumpur,Jumat(8/7/2022).Foto:ANTARA/VirnaPSetyorinijpnn.com,PUTRAJAYA-GelombangCOVID-19diMalaysiaakibatpenularansubvarianOmicronBA.5kecildanterkendali,kataMenteriKesehatanMalaysiaKhairyJamaluddin.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601043357086-0);});Iamengatakan,saatnegara-negaratertentumelaporkangelombangbesarOmicronBA.5,Malaysiamenghadapigelombangkeciltapiberkepanjangan.Sepertiyangsayakatakansebelumnya,(pergerakandari)2.000menjadi5.000kasusmemakanwaktucukuplama.Tidakadapeningkatanyangtiba-tibanaikperlahandandipertahankanpadatingkatyangbaru.Jadiinigelombangbaruyangpanjang,katanyasepertidikutipBernama,Selasa.BacaJuga:Waspada,GejalaCovid-19VarianTeranyar,BedadariJenisLainMengomentarikasusyangkurangdilaporkandiaplikasiMySejahtera,Khairymengatakansituasiitubiasaterjadidinegaramanapun.Jumlahkasusyangdilaporkanlebihsedikitdarijumlahinfeksisebenarnyakarenaprotokolpengujiantelahdilonggarkan.Sebelumini,semuaorangmelakukantesRT-PCR,sekarang,sebagianbesartesyangdilaporkanadalahtesRTK-Antigen,katanya.KhairymengatakanbeberapaindividumelakukantesCOVID-19mandiritetapitidakmelaporkanhasilaplikasiMySejahtera.BacaJuga:KinerjaPositifSelamaPandemiCovid-19,SampoernaRaih2PenghargaanBergengsiDalamhalini,kamimelihatindikatorproxy.Kamitidakmelihatterlalubanyakpadajumlahkasustetapitingkatkeparahannya,jumlahkematiandanperawatandirumahsakit,ujardia.Selamaangkanyaterkendali,makamasalahitubisadiatasidenganbaikkarenajikadilihatdarijumlahkasusnyaakanfluktuatif,danakanadagelombangdariwaktukewaktu,katanya.dovetail fishingAnalisisHotmanParissoalTersangkaBaruKasusBrigadirJ.Foto:FirdaJunita/JPNN.comjpnn.com,JAKARTA-PengacaraHotmanParisHutapeameyakinibahwatersangkabarudalamkasustewasnyaBrigadirJ,bukanorangbiasa.Menurutdia,tersangkabarunantilebihdariduaorang,bahkanmemilikijabatantinggidikepolisian.MungkindariBrigjenatauIrjenPolisi.Sayamelihatbukansatuataudua,bisatigaorang.Inianalisissaya,kataHotmanmelaluiakunnyadiInstagram,Selasa(9/8).BacaJuga:HotmanParisUngkapKondisiKesehatannyaSetelahBerobatkeRumahSakitDiamengatakanbahwasaatinitimkhususbentukanKapolridanpenyidiktelahmenemukanbukti-buktidugaanketerlibatansosokyangmemilikijabatantinggi.Timsusmaupunpenyidiksudahmendapatkanbukti-buktidugaanbahwainibukansekadartembakmenembakmembeladiri,tetapiadafaktorlainkatanya.PengakuanBharadaEyangmengakudiperintahkanuntukmenembakBrigadirJ,lanjutHotman,akanjadipembelaandalampersidangannantiyangbisameringankanhukuman.BacaJuga:SarankanBharadaESegeraUngkapKebenaran,HotmanParis:SebelumTerlambatBharadaEsegerakonsultasidenganpengacaramu,pembelaandenganpasalpidanakita,yaitudugaanmenjalankanperintahatasan,ujarHotman.SeteruRazmanArifNasutioninipunmeyakinibahwakasuspenembakanBrigadirJsudahmulaimenemukantitikterang.IrjenFerdySamboditetapkansebagaitersangkapembunuhanBrigadirJatauNofriansyahYosuaHutabarat.Foto:Ricardo/JPNNjpnn.com,JAKARTA-MisterikematianBrigadirJatauNofriansyahYosuaHutabaratakhirnyaterungkap.TimKhususPolritelahmenetapkanIrjenFerdySambosebagaitersangka.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});MantanKadivPropamituditetapkansebagaitersangkapembunuhanBrigadirJkarenamemerintahkanBharadaEuntukmenembakBrigadirJ.PengumumanFerdySambosebagaitersangkadisampaikanlangsungolehKapolriJenderalListyoSigitPrabowodiMabesPolripadaSelasa(9/8/2022)malam.BacaJuga:BrigadirRRTersangka,ApaPeranAjudanIstriFerdySamboItu?BrigjenAndiSinggung2AlatBuktiKapolrimengatakantimkhususmenemukanbahwaperistiwayangterjadiadalahperistiwapenembakanyangmenyebabkanSaudaraJmeninggaldunia.(Penembakan)DilakukanolehSaudaraE(Bharada)atasperintahSaudaraFS(FerdySambo,Red),kataListyoSigitdiMabesPolri,Jakarta,Selasamalam.Jadibukantembak-tembakansepertiyangdisampaikanpadapenyelidikanawal.BacaJuga:AlasanLemkapiMintaPolriJaminKeamananBharadaE,OhTernyataDalamperistiwaini,timsustelahmenetapkanempatorangsebagaitersangka,yakniIrjenFerdySambo,BharadaE,BripkaRR,danKM.KeempatdisangkakandenganPasal340KUHPsubsiderPasal338junctoPasal55danPasal56KUHPdenganancamanhukumanmatiatauseumurhidup.

IrwasumPolriKomjenAgungBudiMaryotosekaligusKetuaTimsusPolri.Foto:DokHumasPolrijpnn.com,JAKARTASELATAN-Ketuatimkhusus(timsus)PolriKomjenAgungBudiMaryotomengatakanpihaknyamengalamikesulitandalammengungkapkasuskematianBrigadirJatauNofriansyahYosuaHutabarat.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});KesulitaniniterjadipadapekanpertamakasustimsusyangdibentukKapolriJenderalListyoSigitPrabowoitumenanganikasus.KamialamikesulitankarenasaatolahTKPawaltidakprofesionaldanalatbuktipendukungsudahdiambil,kataKomjenAgungBudiMaryotodiRupatamaMabesPolri,JakartaSelatan,Selasa(9/8).BacaJuga:FerdySamboTersangka,KomjenAgusTegasSampaikanKalimatIniPerwiratinggiPolriyangmenjabatIrwasumitulantasmengungkapkanpihaknyajugamendapatkaninformasidaripihakintelijenbahwaadasejumlahpersonelPolriyangmengambilkamerapengawasatauCCTVdilokasikejadian.KamidapatinformasiintelijendariBaintelkamPolribahwadijumpaiadabeberapapersonelyangdiketahuiambilCCTV,ujarmantanKakorlantasPolriitu.Olehkarenaitu,lanjutAgung,pihaknyamembuatsuratperintahgabungandenganmelibatkanDivpropamPolridanBareskrimPolrimelaksanakanpemeriksaankhususterhadap56anggotapolisiyangdidugaterlibat.BacaJuga:FerdySamboJadiTersangka,KuasaHukum:MelindungiMarwahKeluargaDari56tersebutterdapat31personelyangtadidisampaikanKapolriyangpatutdidugamelanggarkodeetikprofesionalPolri,kataAgung.Jenderalpolisibintangtigaitumenyebutkandaripuluhanpersonel,11diantaranyaditahanditempatkhusus.MenteriKoordinatorPolitik,Hukum,danKeamanan(MenkoPolhukam)MahfudMDmengharapkanPolribisamemberikanperlindunganyangmaksimalkepadaBhayangkaraDuaRichardEliezerPudihangLumiualiasBharadaE.IlustrasiFoto:Ricardo/JPNNjpnn.com,JAKARTA-MenteriKoordinatorPolitik,Hukum,danKeamanan(MenkoPolhukam)MahfudMDmengharapkanPolribisamemberikanperlindunganyangmaksimalkepadaBhayangkaraDuaRichardEliezerPudihangLumiualiasBharadaE.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});SayajugasampaikanagarPolrimemfasilitasiLPSKuntukmemberiperlindungankepadaBharadaEagardiaselamatdaripenganiayaan,dariracun,ataudariapapun,katadiadiKantorKemenkoPolhukam,JakartaPusat,Selasa(10/8).Mahfudmenilaipendampinganitusangatperludalamrangkamembuatkasusinisemakinterangbenderang.BacaJuga:BharadaEMauBuka-bukaan,TolongDilindungi,JanganSampaiMatiGegaraDiracunEksKetuaMahkamahKonstitusiitumenganggapBharadaEmerupakansaksipentingdalamkasusini.Kalaudiamenerimaperintah,bisasajabebas,tegasMahfud.Terlepasdariitu,Mahfudmelihatkasusinisudahhampirterungkap.BacaJuga:MenurutKomjenAgus,InilahyangMembuatBharadaEAkhirnyaMauBuka-bukaanPelakudaninstrukturnyadalamkasusinirasanyatidakbisabebas,katadia.Sepertidiketahui,KapolriJenderalListyoSigitPrabowomengumumkanempatorangsebagaitersangkadalamkasuspenembakankepadaBrigadirJ.Satudiantaranya,yakniIrjenFerdySambo.Ilustrasiesbatu.Foto:Pixabayjpnn.com-Esbatudisebut-sebutbisamenyembuhkanasamurat.Kebanyakanorangmengoleskanesbatukeareayangnyeriselamakira-kira10menit.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601113788040-0);});Lalubenarkahesbatubisamenyembuhkanasamurat?Faktanya,esbatutidakdapatmenyembuhkannyeriasamurat.Kompresesbergunahanyauntukmembantumeredakannyeriasamurat.Bukanuntukmenyembuhkanasamurat.Ketikaseseorangmemilikiasamuratyangtinggidanterjadireaksiperadangan,bagiantubuhyangterkenaakanmengalaminyeridanbengkak.BacaJuga:ParaPriaSilakanMerapat,IniCaraMengatasiEjakulasiDiniSecaraAlamiSifatesbatuyangdinginbisamengurangireaksiperadanganakutpadakasusseranganasamurattersebut.Esbatuyangdikomprespadabagianyangsakitdapatmengecilkanpembuluhdarahyangmembesar.Cairan-cairanakibatperadangandansenyawa-senyawaproinflamasipunkemudianakanberkurang.Hasilnya,nyeriakanmenjadiberkurang.BacaJuga:BeginiSudutPandangIslamTentangOnanidanCaraMengatasinyaCaraTerapiEsBatuSaatAsamUratKambuhSaatmengompres,perhatikancaranyaagarlebihmaksimaldalammeminimalkannyeri.Bungkuspotongan-potonganesbatudalamhanduktipiskemudianletakkanpadasendiyangnyeriselama20hingga30menit.Andabisamelakukannyabeberapakalidalamsehari.

KapolriJenderalListyoSigitPrabowomengatakansoalmotifpembunuhanBrigadirJmasihdalamprosespendalamanolehtimsus.Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-MenkoPolhukamMahfudMDmemahamikeputusankepolisianyangbelumbuka-bukaanmengungkapmotifkasuspenembakanterhadapNofriansyahYoshuaHutabaratatauBrigadirJ.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});MahfudMDmendugamotifpembunuhanBrigadirJmasukunsursensitifdanhanyapantasdidengarolehorangdewasa.Mungkinhanyabolehdidengarolehorang-orangdewasa,kataMahfudMDdalamketeranganpersnya,Selasa(9/8).BacaJuga:MenurutKomjenAgus,InilahyangMembuatBharadaEAkhirnyaMauBuka-bukaanMahfudmemercayaikepolisianuntukmengkonstruksimotifdalamkasuspenembakanBrigadirJdemikepentinganpenegakanhukum.DiapadaprinsipnyamengapresiasikepolisianyangmampumengungkapaktorintelektualdalamkasuskematiananggotaBrimobitu.Cumayangpentingsekarangtelurnyasudahpecah,ituyangkamiapresiasidariPolri,ujarmenterikelahiranSampang,Madura,itu.BacaJuga:FerdySamboTernyataBukanCumaMenyuruhMembunuhBrigadirJ,YaAmpun,ParahMotifPembunuhanBrigadirJHarusDijelaskankePublikSementaraitu,anggotaKomisiIIIDPRRIAhmadAlimenyebutpentingbagiPolrimenyampaikanmotifkepadapublikdalamkasuspenembakanterhadapBrigadirJ.Menurutdia,pengungkapanmotifbisamenahanspekulasipublikdalamkasuspenembakanyangterjadidirumahdinasIrjenFerdySamboitu.TaqyMalikbersamaKabareskrimKomjenAgusAndrianto.Foto:Instagram/@taqy_malikjpnn.com,JAKARTA-SelebgramyangjugaseorangpengusahaAhmadTaqiyyunMalikataulebihdikenaldenganTaqyMalikikutangkatbicaraterkaitpenetapanIrjenFerdySambosebagaitersangkapembunuhBrigadirNofriansyahYosuaHutabaratatauBrigadirJ.Timkhusus(timsus)bentukanKapolriJenderalListyoSigitPrabowomenjeratmantanKadivPropamPolriitudenganPasal340subsiderPasal338juntoPasal55dan56KUHPdenganancamanmaksimalhukumanmati.TerkaitperkembangankasuskematianBrigadirJyangakhirnyamenyeretoknumperwiratinggiPolrisebagaitersangka,TaqyMalikmemujisosokjenderalbintangtigainidansepakterjangnya.BacaJuga:IrjenFerdySamboTersangka,AdayangKhawatirNyawaBharadaETerancamSosoktersebutadalahKepalaBadanReserseKriminal(Kabareskrim)PolriKomjenAgusAndriantoyangjugatergabungdalamtimsusbentukanKapolritersebut.BravoKomjenAgus,sosokyangsederhana,berwibawa,dantegas,kataTaqyMalikmelaluiakunpribadinyadiInstagram,yangdikutipRabu(10/8).SuamidariSherelThalibituberharappenetapanIrjenFerdySambodapatterusmenjagakepercayaanpublikterhadapinstitusiPolri.BacaJuga:IrjenFerdySambodiMataKeluargaBrigadirJ,SemuaTerkejutFerdySamboTersangkaKasusPembunuhanBrigadirJ,2PerwiraTinggiIkutTerseretSemogainstansiPolriterusterjagacitranya,Bravo!,ujarmantanmenantupengacarakondangSunanKalijagaitu.(mar1/jpnn)Yuk,SimakJugaVideoini!KapolriJenderalListyoSigitPrabowosaatmengumumkanFerdySambosebagaitersangkapembunuhanBrigadirJdiMabesPolri,Selasa(9/8)malam.TampakjugadisampingSigitadaIrwasumKomjenAgungBudiMaryotodanKabareskrimKomjenAgusAndrianto.Foto:Ricardo/JPNNjpnn.com,JAKARTASELATAN-KepalaBadanReserseKriminalPolriKomisarisJenderalAgusAndriantomenanggapipertanyaanwartawanseputarkasusdugaanpelecehanseksual,yangdilakukanBrigadirYosuaHutabarata.k.aBrigadirJterhadapistriIrjenFerdySambo,PutriCandrawathi.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});KomjenAgusAndriantomenjawabpertanyaansoalperkembangankasusdugaanpelecehanseksualituseusaikonferensipersdiMabesPolri,Selasa(9/8)malam.MenurutjenderalbintangtigakelahiranBlora,16Februari1967tersebut,kecilkemungkinanterjadipelecehanseksualjikaPasal340KUHP(tentangpembunuhanberencana)diterapkandalamkasuspembunuhanBrigadirJ.BacaJuga:IstriFerdySamboAkanDibawakeRuanganKhususKalau(pasal)340diterapkan,kataAguslalusempatterdiam.Kalau340diterapkan,Agusmengulangkalimatnyadankembalidiamsejenak.Agusakhirnyaberkata.Kecilkemungkinanterjadiitu,ujarnyalantasberlalu.BacaJuga:RaguSoalIstriIrjenFerdySambo,Kamaruddin:PutriyangTertukar?DugaanpelecehanseksualmenjadipemicuawalmunculatautersiarnyaperistiwadirumahIrjenFerdySamboyangkiniresmidisebutpenembakan,bukantembak-menembak.KasusdugaanpelecehanseksualitusendiridisebutdilaporkanPutriCandrawathikePolresJakartaSelatan.KemudiankasusituditarikkePoldaMetroJayadankiniadaditanganBareskrimPolri.PelayananSIMKeliling.Ilustrasi,Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-DirektoratLaluLintasPoldaMetroJayamemberikanpelayananSIMkelilingbagipemilikdokumentersebutyangmasaberlakunyaakansegerahabis.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});SIMatauSuratIzinMengemudisendirimemilikimasaberlaku5tahunsejakditerbitkan.PoldaMetroJayamenyiapkan5gerailayananSIMyangtersebardi4wilayahDKIJakartapadaRabu(10/8).BacaJuga:Catatnih,5LokasiLayananSIMKelilingdiJakartaHariIni,Selasa9Agustus2022Dilansirdariakunresmi@TMCPoldaMetrodiTwitter,layananSIMKelilingituberoperasimulaipukul08.00hinggapukul14.00WIB.WargaJakartaPusatyanginginmemperpanjangSIMbisadatangkeKantorPosLapanganBanteng.Lalu,wargayangberdomisilidiJakartaSelatanbisamenujukeKampusTrilogiKalibata.BacaJuga:LayananLokasiSIMKelilingdiJakartaHariIni,Ada5LokasiUntukwargaJakartaTimuryanginginmemperpanjangSIMtersediadiMallGrandCakung.LokasipelayanantersebutjugatersediadiLTCGlodokdanMalCitraland

HotmanParisbicarasoalTersangkaBaruKasusBrigadirJ.Foto:FirdaJunita/JPNN.comjpnn.com,JAKARTA-PengacaraHotmanParisternyatasempatmemprediksisoaltersangkabarudalamkasuskematianBrigadirJ.Diameyakiniadanyapenetapantersangkabarumerujukdarikasustersebutyangmakinterbuka.Inikasussudahmulaiterbukaluas.Yakinsayadalamwaktudekatpenyidikatautimsusakanmengumumkantersangkadariperwirapolisi,ujarHotmanParismelaluiakunnyadiInstagram,dikutipRabu(10/8).RivalRazmanNasutionitumengakusudahmelihatkemungkinantersebutdaritigaharibelakangan.Sebabmenurutnya,halituterlihatjelasdariarahpenyidikan.BacaJuga:IrjenFerdySamboDitetapkansebagaiTersangka,HotmanParisBilangBeginiKelihatanjelasitudariarahpenyidikanselamatigahariini,kataHotmanParis.Dia,bahkanmenyebutjumlahtersangkabaruyangkemungkinandiumumkanolehKapolri.MungkinitudariIrjenmaupunBrigjenpolisidaninisayamelihatbukancumasatuatauduaorang,bisatigaorang.Inianalisasaya,ucapHotmanParis.BacaJuga:AnalisisHotmanParissoalTersangkaBaruKasusBrigadirJ,BeginiKatanyaTerbaru,timkhusus(timsus)PolrimenetapkanIrjenFerdySambosebagaitersangkakasuskematianBrigadirNofryansahYosuaHutabarataliasBrigadirJ.KapolriJenderalListyoSigitPrabowomengatakanpenetapantersangkaterhadapmantanKadivPropamitudilakukansetelahpenyidikmelakukangelarperkaraSelasa(9/8).Ilustrasi-KeluargaBrigadirJ.Foto:MRidwan/JambiEkspresjpnn.com,JAMBI-AyahalmarhumBrigadirJ,SamuelHutabaratmengakuterkejutsaatKapolriJenderalListyoSigitmengumumkanotakpenembakanterhadapanaknyaialahIrjenPolFerdySambo.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});SayasebagaiayahYoshua(BrigafirJ,red)tidakmenyangkajikapelakuutamanyaadalahFerdySambodanterkejutmendengarkanpengumumandarikapolri,ucapSamuelHutabarat,diMuaroJambi,Selasakemarin.KeluarganyajugatidakmenyangkajikakejadianberdarahitudilakukanatasperintahFerdySambo.BacaJuga:JumlahPolisiLanggarKodeEtikdalamPenangananKasusBrigadirJBertambahLagi,Alamak!SelamainianakkamiYoshuayangsudahbekerjaselamaduasetengahtahundenganPakFerdySambotidakpernahmengeluhataspekerjaannyadanmungkindisimpannya,agarkeluargatidakmengetahuinya,imbuhdua.SepanjangBrigadirJberkomunikasidengankeluarga,menurutSamuel,putranyaitutakpernahmengatakanhal-halburukselamamenjadiajudanIrjenFerdy.SaatberkomunikasidengankeluargadiJambi,anakkamiYoshuatidakpernahmembebanipikirankami.BacaJuga:MotifPembunuhanBrigadirJHanyaPantasDidengarOrangDewasa?Ah,TelurnyaSudahPecahBegitujugaketikadiapulangkeJambitidakpernahmengatakanhalyangburukdandiaselalumenceritakanyangbaiksaja,ucapSamuel.KapolriJenderalListyoSigitPrabowomengumumkanempatorangsebagaitersangkadalamkasuspenembakanterhadapBrigadirJ.

dovetail fishing-🎖️togel88 alternatif|XOXE88.COM

VivoX60Pro.ilustrasiFoto:VivoIndonesiajpnn.com,TIONGKOK-Vivodiam-diamakanmerilissmartphonekeluargadariseriX,yakniX80Lite.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601111609478-0);});HalituterungkapdarisetelahnamaVivoX80LiteitudidatabaseGoogleSupportedDevices.TidakhanyaX80Lite,VivoakanmengenalkanHPterbarudalamjajaranIQOOSeries.BacaJuga:VivoX80SeriesResmiDijualdiIndonesia,PalingMurahRp11JutaPonselyangdiberinamaiQOOZ6xitumunculdengannomormodelV2164KA.Hanyasaja,belumadainformasimengenaispesifikasipadaperangkattersebut.Gizmochina,Rabu(10/8),melaporkanZ6xakanbergabungdengankeluargaZ6,yangmencakupiQOOZ65G,iQOOZ6Pro5G,daniQOOZ644W.BacaJuga:VivoY305GMeluncurdengan2KameraBelakang,SebeginiHarganyaPonselseriZ6telahdiubahnamanyamenjadiversiseriVivoT1diIndia.Olehkarenaitu,adakemungkinaniQOOZ6xbisamenjadiversirebrandeddariVivoT1x,yangbaru-baruinimemulaidebutnyadiIndia.GubernurJawaTengahGanjarPranowoNgomonginPolitika.k.aNgompolJPNN.com,diJakarta.Foto:Ricardo/JPNNjpnn.com,JAKARTA-DirekturEksekutifIndoStrategicAkhmadKhairulUmammenyadariGanjarPranowoseksidilantaibursaPilpres2024.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601113788040-0);});Ganjar,sigubernurdariPDIPerjuanganitumemimpinklasemenelektabilitassurveipilpres.Namun,UmammenilaiGanjarbelumberadadifasemendominasi.MasihadaPrabowoSubiantodanAniesBaswedanyangjugamenggoda.BacaJuga:KomunitasOjoldiJakartaUtaraSuarakanGanjarPranowoPresiden2024GanjarmewakilikarakteristikkeberlanjutandarikepemimpinanJokowi,tetapikendalanyadiabukanpemegangkekuatanutama.Adadinamikayangcukupserius.ApakahPDIPmengusungGanjaratautidak?kataUmamdalamdiskusiGanjarBakalTumbangJikaKeluarKandang?yangdiselenggarakanLingkarDiskusiIndonesiadiBakoelKoffie,Rabu(10/8).UmambilangGanjarPranowomasihpunyapilihanskema.DiantaranyadengantetapberadadiPDIP.ElektabilitasGanjardiJawaTengahcukuptinggi,tetapitidakadagapyangsignifikandenganSudirmanSaiddanIdaFauziah,hanyasekitar6-7persen.ElektabilitasGanjarsaatitu(pilgub)tidakberarti,kemenangannyamelaluimesinPDIP,tuturUmam.BacaJuga:RibuanPemudaKapuasDeklarasikanDukunganKepadaGanjarPranowoDiamelanjutkan,GanjarjugabisajalandengankendaraanKoalisiIndonesiaBersatu,tetapiituakanmembuatKetumPDIPMegawatiSoekarnoputribertambahberang.KononGanjarpernahkenasentilBuMegadisebuahrakernasPDIP.ParapengurusGLPGPPPKpusatdandaerahsaatberaudiensidenganpejabatKemendikbudristek.FotodokumentasiGLPGPPPKforJPNN.comjpnn.com,JAKARTA-KetumForumGuruLulusPassingGradePegawaiPemerintahdenganPerjanjianKerja(GLPGPPPK)IswadimenyampaikanhasilpertemuandenganpejabatKemendikbudristek.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});PertemuandihadiriSekretarisDitjenGuruTenagaKependidikan(GTK)KementerianPendidikanKebudayaanRisetdanTeknologi(Kemendikbudristek)NunukSuryani,KabidPerencanaanGTKAndika.JugaparapenguruspusatGLPGPPPKdiantaranyaIswadi,Nuri,Fulkan,danbeberapaperwakilandaerah.DalampertemuanyangdilaksanakandiKantorKemendikbudristekpadaRabu(10/8),terungkapsejumlahinformasipentingdaripejabatKemendikbudristek,yaitu:BacaJuga:BesokGuruLulusPGDiterimaPejabatKemendikbudristek,SemogaAdaSolusiTerbaik 1.Dataexcelyangberedarmengenaipenempatanbynamabyaddressadalahtidakbenarkarenaituadalahmasihsimulasi.2.KuotaPPPKyangdiajukanpanselnaskepadaPemdasudahfinal.3.ByNamebyaddresspenempatanPPPKbelumfinal.BacaJuga:GuruLulusPGMasukPendataanHonorer,PenjelasanPanselnasBikinTenang4.JuknispelaksanaanPPPKrekrutmentahun2002turunawalSeptember.MenurutIswadi,hasilaudiensihariinibelummemuaskangurululusPG.Sebab,masihbanyakyangtidakbisaditempatkan,yaitugurubahasaInggrisdanPKWU.LembagaPerlindunganSaksidanKorban.Foto:Ricardo/JPNN.comjpnn.com,CIRACAS-WakilKetuaLembagaPerlindunganSaksidanKorban(LPSK)EdwinPartogiPasaribumembukaucapanyangkeluardarimulutistriIrjenFerdySambo,PutriCandrawathi.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Ucapanitutakpanjang.Yangterucaphanyaitu.Malu,Mbak.Malu.kataEdwinkepadawartawandikantorLPSK,Ciracas,JakartaTimur,Rabu(10/8).BacaJuga:SehariSebelumMenjadiTersangkaPembunuhanBrigadirJ,FerdySamboBerhadapandengan2KomjenIniMalunyakenapakamienggaktahu,imbuhnya.BuPutrimengatakanitusaatdiperiksatimasesmenpsikologisLPSKdikediamanpribadiSambodiJalanSagulingIII,DurenTiga,Pancoran,JakartaSelatan,Selasa.EdwinjugamengungkapkondisimentalNyonyaSambomemprihatinkan.BacaJuga:PagiPresidenJokowiUnggahPernyataanTegas,MalamnyaFerdySamboTersangkaIbuPsukamenangis,murung,tidakbisamemberiketerangan.Adahallainyangspesifikdiobservasipsikiater,tuturEdwin.LPSKmenilaipsikologisPutriCandrawathimasihperluperhatian.

IstriIrjenFerdySambo,PutriCandrawathi.Foto:AntaraVideo-SumberVideoFachmyFebrianjpnn.com,JAKARTASELATAN-PutriCandrawathi,istriIrjenFerdySamboturutmenyaksikansaatpenyidiktimkhusus(timsus)PolrimenggeledahrumahpribadinyadiRT07RW02JalanSaguling,KompleksPertambangan,DurenTiga,Pancoran,JakartaSelatan(Jaksel),Selasa(9/8).googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Ketuarukuntanggasetempat,YosefmengatakanPutrihanyamenangisketikapenyidikmenggeledah.Iya,diamenangisterusdikamar,susahkamiberkomunikasi,kataYosefdikutipdariAntara,Rabu(10/8).BacaJuga:KPKBelumBisaUmumkanHartaKekayaanIrjenFerdySambo,AdaApa?YosefmengatakandirinyadimintaikuthadirdalamprosespenggeledahanbersamatimkhususpadaSelasa.KetikaitukeadaanPutriterlihatbaik-baiksajanamunpengacaramenyebutnyamenangisterusdidalamkamar.Yosefmengakumelihatadabeberapaorangyaknipengacara,polisiwanita(polwan),danBareskrimikutdalamprosespenggeledahanselamasembilanjam.BacaJuga:BenarkahPutriCandrawathiMengalamiPelecehanSeksual?IniKataKabareskrimAdajugakeduaanakFerdySambodanPutriyakniseoranganakperempuandananaklelakinyapalingkecilberumur1,5tahunbersamapengasuhnyajugaberadadidalamrumah.KeluargaFerdySambotinggaldirumahtersebutkuranglebihsetahunsehinggabelumterlalumengenalkawasanJalanSaguling.ReserseMobile(Resmob)PolresSerangmembekuksatpampabrikKawasanIndustriJababeka,CikarangSelatan,KabupatenBekasi,JawaBarat,yangmerampokRp100jutaditokohandphoneSahabatSelulerdiPasarTambak,Kibin,KabupatenSerang.ANTARA/HO-PolresSerangjpnn.com,SERANG-ReserseMobile(Resmob)PolresSerangmembekuksatpampabrikKawasanIndustriJababeka,CikarangSelatan,Bekasi,JawaBarat.DiadidugamerampokRp100jutaditokohandphoneSahabatSelulerdiPasarTambak,Kibin,KabupatenSerang.PelakuperampokanituberinisialIB(29)wargaBekasi,kataKapolresSerangAKBPYudhaSatriadiSerang,Rabu(10/8).PeristiwaperampokanterjadipadahariSabtu(6/8)pukul22.30WIB.Saatitu,tokobarututupdansejumlahkaryawansudahpulang.BacaJuga:4MalingMotorDiringkusPolisi,PengakuanMerekaMencengangkanPelakuyangmenggunakantopengdangolokitulangsungmenerobosmasuktokolewatpintubelakang.PelakumasukdanlangsungmenodongkangolokkekorbandanmengeluarkanplastikagarkorbanmemasukkanHPdanuang,kataYudha.PemiliktokoNH(41)pasrahmenghadapiancamanperampokyangakanmembacoknya,kemudianmenyerahkanuangRp100jutakedalamkantongplastik.Padasaatitu,pelakumemintakorbanagarmenyerahkanseluruhhandphone.Namunkorbanmenyebutkanbahwaseluruhponselsudahdimasukkankedalambrankas.Pelakuhanyamendapatkanuanglalukeluartokodanmenguncikorbandariluar,kataYudhaSatria.BacaJuga:PerampokBersenpidiApotekMedanAmbrukDiterjangTimahPanas,Bravo,PakPolisiPerampokBersenjatadiApotekDitembakPolisiDalammengungkapkasusitu,polisihanyamembutuhkanwaktuempathari.PolisimenangkapIBditempatkerjanya,Selasa(9/8).Darihasilpenggeledahan,kataYudha,petugasmengamankansejumlahbarangbukti,antaralainsatuunitHondaVario,duacincinemas,duaponsel,sertasejumlahalatuntukmerampok.(antara/jpnn)BeritaSelanjutnya:IdentitasPerampokyangMenewaskanSopirTaksiOnlineSudahDikantongi,Siap-SiapSajaBekRealMadrid,DavidAlaba(jerseiputih)saatmelawanpemainEintrachtFrankfurt(jerseihitam)difinalUEFASuperCup2022.Foto:Twitter/ChampionsLeague.jpnn.com,HELSINKI-RealMadridmenasbihkandirinyasebagaiRajaEropasetelahmempermalukanEintrachtFrankfurtdifinalUEFASuperCup2022.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601051053163-0);});Duagolyangmasing-masingdilesatkanolehDavidAlaba(37)danKarimBenzema(65)membawaMadridunggul2-0padalagayangdihelatdiStadionOlimpiadeHelsinki,Kamis(11/8/2022)dinihariWIB.JalannyaPertandinganBacaJuga:PengamatMintaPSMMakassarWaspadaiKualaLumpurCityFC,IniPemicunyaMadridlangsungtancapgassejakmenitawal.JawaraLigaChampionsituterusmencecarpertahananFrankfurtselakukampiunLigaEuropa.Namun,Madridbarubisamembukakeunggulanpadamenit37.UmpandariCasemiromampudituntaskanmenjadigololehAlabasehinggapapanskorberubahmenjadi1-0hinggaturunminum.Dalamkeadaantertinggal,FrankfurtberupayauntukmenekanMadrid.Akantetapi,skortetaptidakberubah.ElRealtetapmemimpin1-0.BacaJuga:BawaIndonesiakeFinalPialaAFFU-162022,BimaSaktiKokMintaMaaf,AdaApa?Padababakkedua,Madridtampakmasihlebihmendominasi.FrankfurtmasihsajakesulitanmenembuspertahanananLosBlancosyangdikawalduetDavidAlabadanEderMilitao.Madridkemudianmenambahkeunggulannyamenit65.AsisstViniciusJuniordisambutdengansepakanmendatarolehKarimBenzemayangtakmampudihalaukiperFrankfurt,KevinTrapp.KuasahukumkeluargaBrigadirJatauNofryansahYosuaHutabarat,KamaruddinSimanjuntak(kanan)danJohnsonPanjaitandiBareskrimPolribeberapawaktuyanglalu.Foto:Ricardojpnn.com,JAKARTA-SelamatpagipembacasetiaJPNN.com,hariinikamisajikanberitaterpopulersepanjangRabu(10/8)tentangsebuahmisterikepemilikansenjatauntukmembunuhBrigadirJterungkap,satudariempattersangkapembunuhanBrigadirJmuncul,hinggaperintahFerdySamboparah.Simakselengkapnya!googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Janganlupaya,tetappakaimaskersaatbepergian,rutinmencucitangandanmenjagajarakkarenapandemiCovid-19belumberakhir.1.FerdySamboTernyataBukanCumaMenyuruhMembunuhBrigadirJ,YaAmpun,ParahBacaJuga:5BeritaTerpopuler:5PengakuanTerbaruBharadaETerungkap,LPSKMendadakBungkam,KomjenAgusMeresponsTegasMisterikematianBrigadirJatauNofriansyahYosuaHutabaratakhirnyaterungkap.TimKhususPolritelahmenetapkanIrjenFerdySambosebagaitersangka.MantanKadivPropamituditetapkansebagaitersangkapembunuhanBrigadirJkarenamemerintahkanBharadaEuntukmenembakBrigadirJ.PengumumanFerdySambosebagaitersangkadisampaikanlangsungolehKapolriJenderalListyoSigitPrabowodiMabesPolripadaSelasa(9/8/2022)malam.BacaJuga:5BeritaTerpopuler:BharadaELegaMembongkarKasusBrigadirJ,AdaRahasiaBesarhinggaUrusanCintaBacaselengkapnya,kliklinkdibawah:FerdySamboTernyataBukanCumaMenyuruhMembunuhBrigadirJ,YaAmpun,Parah

TersangkaMRsaatdiamankandiPolresRejangLebong.Foto:doklinggauposjpnn.com,REJANGLEBONG-JajaranPolresRejangLebongmembongkarkelakuanasliseorangkhatibmasjidberinisialMR(43)diBengkulu.MRyangselamainidikampungnyadikenalsebagaikhatibmasjidternyatapredatoranak.Korbannyaputrinyasendiri.BacaJuga:DiMasjidMRJadiKhatib,SampaidiRumahBerubahMonster,Biadab!BacaJuga:PerbuatanSopirAngkotIniSungguhBikinEmosiTingkatTinggiPriaparuhbayaituternyatatelahmelakukanhalpalingkejiterhadapanaknyasendiriyangmasihberusia9tahun.WargaRejangLebong,Bengkuluitumemerkosaanaknyasendiri,bahkanitusudahdilakukansejak2019lalu.PerbuatankejiterakhiryangdilakukanMRpadaSelasa(9/8)kemarin.BacaJuga:IstrinyaDigoda,MemedBacokAlpian,TempatPijatBanjirDarahAksibejatnyaitudiketahuitetanggasehinggasampaikemejaPolsekBermaniUlu,RejangLebong.KapolresRejangLebongAKBPTonnyKurniawanmenjelaskantersangkaditangkapberdasarakanlaporankorbandidampingitetangga.Sejumlahpersoneltampaksedangberbaris.Foto:Ricardo/JPNN.jpnn.com,JAKARTA-KepolisianRepublikIndonesia(Polri)memiliki434.135personelyangtersebardiseluruhwilayahnusantara.Setiappolisimemilikipangkatsesuaidenganseleksipendaftarandanberapalamamerekamengabdidikorpsbajucokelat.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});SistemkepangkataninisudahdiaturdalamPeraturanKapolriNomor3Tahun2016tentangAdministrasiKepangkatanAnggotaKepolisianRepublikIndonesiadalamBabIItentangGolonganKepangkatanPasal3.AdapunjenjangkepangkatanPolriterbagimenjaditiga,pertamaadatamtama,keduabintara,danketigaperwira.BacaJuga:31AnggotaPolisiMelanggarKodeEtikDalamPenangananKasusKematianBrigadirJ,ApakahAdadariKedokteranForensik?TamtamaDimulaidaripangkatterendahadapadajenjangtamtama.1.BhayangkaraDua(Bharada)Iniadalahpangkatterendahdikepolisianketikaseseoranglulusseleksipendaftarantamtamadansudahmenjalanipendidikan.BacaJuga:IniDaftarNama32PolisiBerprestasiPenerimaKenaikanPangkatLuarBiasadariKapolriBentukpangkatbharadainiadalahgarismiringsatu.2.BhayangkaraSatu(Bharatu)

dovetail fishing-🎖️togel88 alternatif|XOXE88.COM

ParapemainRealMadridsaatmerayakangelarUEFASuperCup2022.Foto:Twitter/ChampionsLeague.jpnn.com,HELSINKI-RealMadridsuksesmenggondoltrofiUEFASuper2022setelahmenaklukkanEintrachtFrankfurt.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601051053163-0);});BermaindiStadionOlimpiadeHelsinki,Kamis(11/8/2022)dinihariWIB,ElRealunggul2-0atastimJermantersebut.DuagolkemenanganMadridlahirlewataksiDavidAlaba(37)danKarimBenzema(65).BacaJuga:UEFASuperCup2022:PermalukanFrankfurt,RealMadridRajaEropaRaihanpositifinitakterlepasdaripenampilangemilangsejumlahpenggawaElReal.Darisekianbanyaknama,adasetidaknyalimapemainyangpalingmenonjol.Siapasajamereka?Simakulasannyaberikutini.1.CasemiroGelandangasalBrasilinimenjadipemutusseranganFrankfurtsebelummenembuspertahananElReal.Total,Casemiromampumelakukansembilantekelsukses,duaintersep,dansatublok.BacaJuga:BosPSMMintaPerubahanJadwalPertandinganLiga1,IniPenyebabnyaTakcumaitu,CasemirojugaaktifmembantuseranganElRealdengancatatan54umpanakuratdari64percobaan.Takayal,WhoScoredmemberinyanilai8,6,yangtertinggidibandingpemainMadridlainnya.2.KarimBenzemaLagidanlagi,Benzemamembuktikanbahwadirinyabelumhabis.StrikergaekasalPrancisitumenunjukkankualitasnyasebagaifinisherulung.Kankerotak(Ilustrasi).Foto:Ricardo/JPNN.comjpnn.com-Penyebabkankerotakmasihbelumdiketahuisecarapasti.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601113788040-0);});Namun,terdapatbeberapafaktoryangdidugamembuatseseoranglebihrentanmengalamikankerotak,diantaranyaadanyamutasigenetik,riwayatkankerotakdalamkeluarga,usiatua,danpaparanradiasi.Makananternyatajugabisamenjadifaktorrisikokankerotak.Karenaitu,kitapatutwaspadaketikaakanmengonsumsimakanantertentu.BacaJuga:BenarkahEsBatuBisaMenyembuhkanAsamUrat?Marikenalijenis-jenismakananpenyebabkankerotakberikutini:1.AlkoholKonsumsialkoholberhubungandengantimbulnyabeberapajeniskanker,sepertikankermulut,kankernasofaring,kankeresofagus,kankerpayudara,hinggakankerotak.Risikokankerakanmeningkatapabiladosisalkoholyangdikonsumsiberlebihan,apalagidisertaikonsumsitembakau.BacaJuga:BolehkahBerhubunganBadanSaatSedangInfeksiSaluranKemih?Olehkarenaitu,sebaiknyabatasikonsumsialkohol,bahkanbilaperluhindari.2.MakananyangBerjamurBeberapajenisjamur,salahsatunyaAspergillusflavus,mengandungmetabolitaflatoksin.JamurAspergillusflavusdapatmenjadiparasitpadakacang,pohonkacang,danbiji-bijian.

IrjenFerdySamboditahandiMakoBrimob.Foto:Ricardo/JPNN.comjpnn.com,JAKARTASELATAN-Penyidiktimkhusus(timsus)PolrimelakukanpemeriksaanperdanaterhadapIrjenFerdySambosebagaitersangkakasusdugaanpembunuhanBrigadirJatauNofriansyahYosuaHutabarat.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});PemeriksaanterhadapmantanKadivPropamitudilakukandiMakoBrimob,KelapaDua,Depok,hariini,Kamis(11/8).Hariini,penyidiktimsusmelakukanpemeriksaanterhadapIrjenFSsebagaitersangkadiMakoBrimob,kataKadivHumasPolriIrjenDediPrasetyokepadawartawan.BacaJuga:KomnasHAMPeroleh5DataRekamanCCTVsoalPenembakandiRumahFerdySambo,Isinya?Selainitu,kataDedi,penyidiktimkhususjugamelakukanpemeriksaanterhadaptersangkalainnyayakni,KMdiGedungBareskrimPolri,JakartaSelatan.PemeriksaankeduadilakukankepadaKMsebagaitersangkadiBareskrim,ujarDedi.Secaraparalel,Dedimenyebut,pihakInspektoratKhusus(Irsus)PolrijugamenjadwalkanmelakukanpemeriksaanterhadapsatuorangpenyidikyangbertugasdiPoldaMetroJayaterkaitkasuspenembakanBrigadirJ,padahariini.BacaJuga:HotmanParisMenyindirIstriIrjenFerdySambo,BeginiKatanyaDedimenyebutpemeriksaanitudilakukandiMabesPolri.SedangkanIrsus,agendanyapadahariinimelakukanpemeriksaankepadasatuorangpenyidikPoldaMetroJaya,jam10.00WIBdiMabesPolri,ucapDedi.AudiensipengurusGLPGPPPKdenganSesditjenGTKKemendikbudristekNunukSuryani.Foto:DokumentasiGLPGPPPKforJPNN.comjpnn.com,JAKARTA-Pemerintahberencanamenerbitkanpetunjukteknis(juknis)rekrutmenpegawaipemerintahdenganperjanjiankerja(PPPK)awalSeptember.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Namundemikian,gurululuspassinggrade(PG)PPPKjustrupesimistisjadwalpenerbitanjuknisituakanmolorlagi.KetuaForumGuruLulusPassingGradePegawaiPemerintahdenganPerjanjianKerja(GLPGPPPK)IswadimengungkapkanKementerianPendidikanKebudayaanRisetdanTeknologi(Kemendikbudristek)memangsudahmenginformasikanagarmenunggujuknisturun.BacaJuga:PemkabBogorAjukanPenambahanFormasiPPPK2022,PalingBanyakuntukGuruSekretarisDitjenGuruTenagaKependidikan(GTK)NunukSuryanibahkanjugamemintaparagurululusPGagartidakmempercayaidataExcelyangberisidaftarnamadanpenempatankarenasemuanyamenunggujuknis.Meskidemikian,kataIswadi,gurululusPGkhawatirjadwalpenerbitanjuknisitumoloraliastidaktepatwaktu.Jujursaja,kamipesimistisakantepatwaktu,karenamasihharusdirapatkandenganpihak-pihakterkait,terangIswadikepadaJPNN.com,Kamis(11/8).BacaJuga:THPGuruPPPKRp6Juta,PNSRp14Juta,KepalaBKNMerespons,BersyukurlahIswadidanrekan-rekannyamakingusarkarenasaatmerekabertanyakapanseleksiPPPK2022dibuka,tidakadajawabandantimelinejugatakdiberikan.Diamendugahalituterkaitdenganpendataanseluruhtenaganon-aparatursipilnegara(non-ASN)yangsementaraberjalandiseluruhdaerah.PutriCandrawathi(kanan)diMakoBrimob,KelapaDua,Depok,JawaBarat,Minggu(7/8).Foto:AntaraVideo-SumberVideoFachmyFebrianjpnn.com,JAKARTA-KalimatyangkeluardarimulutPutriCandrawathikepadatimdariLembagaPerlindunganSaksidanKorban(LPSK),masihmenjaditandatanyabesar.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});TimLPSKsebelumnyamelakukanasesmenterhadapistrimantanKadivPropamPolriIrjenFerdySamboitudirumahJalanSagulingIII,DurenTiga,Pancoran,JakartaSelatan.PutrimerupakansalahsatusaksikuncikasuspembunuhanberencanaterhadapYosuaHutabarataliasBrigadirJyangmelibatkanBharadaE.BacaJuga:IstriIrjenFerdySamboPutriCandrawathiKenapaMalu?EdwinTakTahuKonon,peristiwapembunuhanBrigadirJyangdidugadidalangiIrjenSambo,dipicudugaanpelecehanseksualterhadapPutri.MengacupenjelasanWakilKetuaLPSKEdwinPartogiPasaribu,Putrihanyamengucapkankata-katasingkat.Itupun,adasatukatayangdiulangduakaliolehPutri.BacaJuga:KomjenAgusTegaskanBharadaEMengakukarenaKegigihanPenyidikdanTimsus,BukanPengacaraYangterucaphanyaitu;Malu,Mbak.Malu,ucapEdwinPartogimenirukanmengungkapperkataanPutrikepadawartawandikantorLPSK,Ciracas,JakartaTimur,Rabu(10/8).Namun,EdwinmengakutidakpahamdengankatamaluyangdimaksudPutriCandrawathi.Timkhusus(timsus)mengagendakanpemeriksaanterhadapIrjenFerdySambosebagaitersangkakasuspembunuhanBrigadirNofryansahYosuaHutabaratatauBrigadirJpadaKamis(11/8).IlustrasiFoto:Ricardo/JPNN.comjpnn.com,JAKARTA-Timkhusus(timsus)mengagendakanpemeriksaanterhadapIrjenFerdySambosebagaitersangkakasuspembunuhanBrigadirNofryansahYosuaHutabaratatauBrigadirJpadaKamis(11/8).googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});KepalaDivisiHubunganMasyarakat(KadivHumas)PolriIrjenDediPrasetyomengatakanpemeriksaanterhadapmantanKadivPropamPolriitudilakukandimarkasKomjenAnangRevandoko.Hariini,penyidiktimsusmelakukanpemeriksaanterhadapIrjenFS(FerdySambo,red)sebagaitersangkadiMakoBrimob,kataDedidalamketerangannya,Kamis(11/8).BacaJuga:HotmanParisMenyindirIstriIrjenFerdySambo,BeginiKatanyaJenderalbintangduaitumengatakantimsusjugamelakukanpemeriksaanterhadaptersangkalainnyayakni,KMdiGedungBareskrimPolri.PemeriksaanjugadilakukankepadaKMsebagaitersangkadiBareskrimPolri,kataDedi.Disisilain,InspektoratKhusus(itsus)PolrijugamenjadwalkanpemeriksaanetikterhadapsatuorangpenyidikyangbertugasdiPoldaMetroJaya.BacaJuga:5BeritaTerpopuler:MotifPembunuhanBerencanaBrigadirJTerungkap,1dari4TersangkaMuncul,FerdySamboTernyataPemeriksaandilakukandiMabesPolri.ItsusagendanyapadahariinimelakukanpemeriksaankepadasatuorangpenyidikPoldaMetroJayapukul10.00WIBdiMabesPolri,tuturDedi.IstriIrjenFerdySambo,PutriCandrawathi(kanan)saatdidepanMakoBrimobDepok.Foto:AntaraVideo-SumberVideoFachmyFebrianjpnn.com,JAKARTA-PakarpsikologiforensikRezaIndragiriAmrielmenyampaikananalisisperihalkatamaluyangkeluardarimulutPutriCandrawathisaatasesmenolehtimdariLembagaPerlindunganSaksidanKorban(LPSK).googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});PutrimerupakansalahsatusaksikuncikasuspembunuhanberencanaterhadapBrigadirJyangmelibatkanBharadaEyangdidalangiolehmantanKadivPropamPolriIrjenFerdySambo,suaminyaPutri.Konon,peristiwapembunuhanBrigadirJdipicudugaanpelecehanseksualterhadapPutri.BacaJuga:PutriCandrawathi2KaliBilangMalu,TerkaitMotifPembunuhanBrigadirJ?WakilKetuaLPSKEdwinPartogiPasaribusebelumnyamenyebutPutriCandrawathihanyamengucapkankata-katasingkatsaatasesmen.Yangterucaphanyaitu;Malu,Mbak.Malu,kataEdwinmenirukanucapanPutri.DiapuntidaktahukenapaistriFerdySambobilangmalu.RezaIndragiripunmengungkapanalisisnyasaatdiwawancaraJPNN.com,Kamis(11/8).BacaJuga:IstriFerdySamboMengakuMalu,AnalisisRezaIndragiri:AdaHalBurukSayamalukeluardariorangyangmenganggapdirinyatelahmelakukanbukandiperlakukansesuatuyangburuk,atauketikaorangitumelihatpihaklainmelakukanhalyangburuk,kataReza.LantasadakahkaitankatamaluyangdiucapkanPutriSambodengandugaanMahfudMDbahwamotifpembunuhanBrigadirJmungkinhanyabolehdidengarolehorang-orangdewasa?HinoDutroZEVyangmejengdiGIIAS2022.Foto:Antarajpnn.com,TANGERANG-PTHinoMotorsSalesIndonesia(HMSI)memamerkansejumlahjajaranproduknyadiajangGaikindoIndonesiaInternationalAutoShow(GIIAS)2022diICEBSD,Tangerang,Kamis(11/8).googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601110242209-0);});AdapunprodukyangdibawamulaidaritrukkonvesionalhinggabertengalistrikuntukdikenalkankepadapublikdiIndonesia.Kamimenghadirkanberbagaikendaraanuntukmembantuparapengusahaperkebunan,pertambangan,logistik,hinggatransportasi,kataPresidenDirekturHMSIMasatoUchidasaatkonferensipersdiacaratersebut,Kamis.BacaJuga:TrukHinoTerguling,8TonMinyakGorengTumpahJadiKayakBeginiDiamenambahkantruklistrikyangdiberinamaHinoDutroZEVitumenggunakantipebateraiLithiumIondengankapasitas40kWhuntukpenyalurantenagakemotorlistrik.HinoDutroZEVmenggunakantipenormalchargingACtype1denganwaktu5jamatauquickchargingDCCHAdeMohanyadalamsatujam.Dalamkeadaanbateraipenuhtrukitubisamenempuhjaraklebihdari100kmdanmemilikidayaangkuthinggasatuton.BacaJuga:HinoIndonesiaPastikanSemuaJajaranTrukdanBusSudahStandarEuro4Kemudian,HinojugamemperkenalkaninovasiprodukHino200Seriesyangmemilikitenaga144PS/3.400rpmdenganmesinEuro4dantransmisi5percepatan.Trukitusangattepatuntukbisnispengirimansehari-haridenganjarakpendekdanmenembusjalansempit.

InstitutSainsdanTeknologiNasional(ISTN) menawarkanbeasiswabagimahasiswasehinggabisakuliahgratissampaiselesai.FotodokumentasiISTNjpnn.com,JAKARTA-InstitutSainsdanTeknologiNasional(ISTN)membukapendaftaranbeasiswakuliahpenuhempattahundanprogramkeringanan50persen.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601113788040-0);});BeasiswaempattahunpenuhmerupakanpengabdianISTNyangsudahberdirisejak1950kepadamasyarakatdalammengimplementasikanPancasilamencerdaskankehidupanbangsa.KepalaLembagaKomunikasiPublikdanPemasaran(LKPP)ISTNTaufikHidayat,ST,MTmengatakanprogrambeasiswaempattahuninimenyediakanuntukprogramstudimatematikadanfisikayangpendaftarannyadilakukansecaraonline.BacaJuga:ISTNMendapatkanDanaHibahPenelitiandariKemendikbudristekPesertayangmengikutiprograminiakanbebasuangkuliahselamaempattahunatausampailulusselamamengikutisyaratdanketentuanyangberlaku.PerkuliahanakandimulaipadaSeptemberyangmanapendaftaranbeasiswainiberlakusampaidenganAgustus2022,kataTaufikHidayatdalamketerangannya,Kamis(11/8).DiamengungkapkanperanISTNsebagailembagapendidikanyangsalahsatutugasnya,yaitupengabdiankepadamasyarakat.BacaJuga:ISTNKembaliMeluluskan421SarjanaTangguhTaufikberharapdariprogrambeasiswainisalahsatunya,yaitubentukpengabdianmasyarakatISTNselakulembagapendidikan,terlebihlagidimasapandemiyangmenyebabkanbanyakorangterkenadampakdaripandemiini.Programkeringanan50persen,lanjutTaufik,merupakanupayaISTNyangmemilikiakreditasiBBAN-PTsebagailembagapendidikandalammendukungprogrampemerintahdalammemberikanbantuanpendidikanterutamadimasapandemi.AnakbuahIrjenFadilditahanditempatkhususdiMakoBrimobseusaidiperiksaItsusPolribuntutkasustewasnyaBrigadirJ.Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-InspektoratKhusus(Itsus)PolritelahmemeriksapenyidikPoldaMetroJayayangdidugamelakukanpelanggaranetikbuntutpenanganankasustewasnyaBrigadirNofryansahYosuaHutabarataliasBrigadirJ.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});PemeriksaanterhadapanakbuahIrjenFadilImranberpangkatAKBPitudigelardiBareskrimPolripadahariini,Kamis(11/8)pukul10.00WIB.ItsussudahperiksasatupenyidikPoldaMetroJaya,kataKadivHumasPolriIrjenDediPrasetyodiMakoBrimob,KelapaDua,DepokpadaKamis(11/8)malam.BacaJuga:IrjenDediSebut31PolisiLanggarKodeEtikOlahTKPKematianBrigadirJHasilpemeriksaanitu,Itsusmemutuskanuntukmenahanpenyidiktersebutpadatempatkhusus(Patsus)diMakoBrimob.Kendatidemikian,IrjenDeditakmemerinciidentitaspenyidikberpangkatAKBPitu.Darihasilriksa,langsungditempatkanditempatkhsuusMakoBrimob.Soreini(penyidikyangdiperiksa,red)berpangkatAKBPditaruhdiPatsus,ujarDedi.BacaJuga:BeredarRekamanCCTVMenyangkutPembunuhanBrigadirJ,IrjenDediBilangBeginiDalamkasusini,BharadaEmenembakmatiBrigadirJdiDurenTiga,JakartaSelatanpadaJumat(8/7).BharadaEmenembakmatiBrigadirJatasperintahIrjenFerdySambo.

IrjenFerdySambo.Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-EksKadivPropamPolriIrjenFerdySambomengucapkanpermintaanmaafkepadarekansejawatnyadiPolri,keluarga,danmasyarakatyangterdampakdaripolemikdalamkasuspembunuhanNofriansyahYoshuaHutabaratatauBrigadirJ.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});PermohonanmaafdariIrjenFerdySamboitusepertidisampaikanpengacaranya,ArmanHaniskepadaawakmediadiJakarta,Kamis(11/8).Secaratulusmemintamaafdanmemohonmaaf,kataArmanmembacakansuratpermohonanmaafdariIrjenFerdySambo.BacaJuga:AmarahFerdySamboMemuncakSetelahPutriCandrawathiMelaporSoalIniEksDirekturTindakPidanaUmumBareskrimitusadarpolemikdalamkasustewasnyaBrigadirJbermuaradariperbuatannyayangmemberikaninformasitidakbenar.Memberikaninfomasiyangtidakbenarsertamemicupolemik,ujarnya.IrjenFerdySamboberjanjiakanpatuhdanmengikutisetapproseshukumyangsaatinisedangberjalanataunantidipengadilan.BacaJuga:IrjenFerdySamboMintaMaafkeKapolriHinggaMasyarakat,TetapiTidakMemuatKeluargaBrigadirJAkansayapertanggungjawabkan,ungkapalumnusAkpol1994itu.IrjenFerdySambodalamsuratnyakemudianmengakuhanyaberupayamenjagadanmelindungimuruahkeluargasehinggadirinyaterlibatdalamkasustewasnyaBrigadirJ.PakarpsikologiforensikRezaIndragiripunyaanalisistentangkatamaluyangdiucapkanistriFerdySambo.IlustrasiFoto:AndikaKurniawan/JPNN.comjpnn.com,JAKARTA-PakarpsikologiforensikRezaIndragiriAmrielpunyaanalisismenariktentangkatamaluyangkeluardarimulutPutriCandrawathi.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});KataitusebelumnyadisampaikanistriFerdySambotersebutketikaberhadapandengantimasesmendariLembagaPerlindunganSaksidanKorban(LPSK).DemiAllah.Saatmenontonlive-nyawaktu(Putri)munculdidepanMakoBrimob,sayamembatin,inimenahansedihataumenahanmalu?jawabRezasaatberbincangdenganJPNN.com,Kamis(11/8).BacaJuga:PutriCandrawathi2KaliBilangMalu,TerkaitMotifPembunuhanBrigadirJ?RezaIndragirilantasmenyampaikananalisisbahwaperasaanmalubisadipilahkedalamduaragam.Pertama,malusebagaiperasaantidaknyamanyangmunculketikasisidiriatauperbuatanseseorangtereksposkepihaklaindanitumerusakcitrayanginginorangtersebutbangun.Sisidiriatauperbuatanitubersifatumumbelaka.Misalnya,ngupil,ucappenyandanggelarMCrim(Forpsych-masterpsikologiforensik)dariUniversitasofMelbourneAustraliaitu.BacaJuga:PolisiPerluUsutKeterlibatanFahmiAlamsyah,BisaDijeratPasalPermufakatanJahatMenurutdia,ngupilpadadasarnyabagus,yaknibentukpedulipadakesehatandengancaramengorekhidungagarbersihdarikotoran.namun,ketikaaktivitasituternyatadilihatpihaklain,malahmunculsensasisayamelakukankegiatanyangkotor.Ngupilnyasebetulnyabagus,tetapimenjadijelekkarenadilihatolehpihaklain.Iniadalahembarrasement.Diindonesiakansepadandenganmalu,terangnya.

PengacaraHotmanParis.Foto:Romaida/JPNN.comjpnn.com,JAKARTA-DuniaentertainmentJPNNsepanjangJumat(11/8)diramaikandenganpernyataanHotmanParisHutapeasoalkasusBrigadirJ.PengacaranyentrikinimenyorotilaporanistriFerdySambo,PutriCandrawathisoaldugaanpelecehanseksual.HotmanlantasmemberisindiranpedasuntukPutriCandrawathi,terkaitkasusdugaanpelecehandankematianBrigadirJ.BacaJuga:HotmanParisSebutIstriIrjenFerdySambosudahMenangisdariMagelang,AdaApa?Selainitu,penyukaberliandanmobilmewahinimakinpenasarandenganmotifBharadaEyangmenembakmendiangBrigadirJ.Pengintahulebihlengkapnya?Simakrangkumanberitanyaberikutini:1.KasusDugaanPelecehanHotmanmengakupenasaranlantaranistriIrjenFerdySamboitumasihngototmelanjutkankasustersebut.BacaJuga:HotmanParisAkanTerusMemburuRazmandanTeman-temannya,Siap-Siap!Kan,yangdidugapelakualmarhum,kan,sudahmeninggalberartikasusselesai,kataHotmanparis.Bacaselengkapnya:IstriFerdySamboNgototLanjutkanKasusDugaanPelecehan,HotmanParisBilangBeginiWingerTimnasIndonesiaEgyMaulanaVikrisaatberlatihbersamaFKSenica.Foto:Twitter/Egymv1jpnn.com,ZLATEMORAVCE-AdasejumlahalasanyangmembuatFCViONZlateMoravcetertarikmemboyongEgyMaulanaVikri.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601051053163-0);});Melansirtransfermarkt,klubasalSlovakiaitumengikatEgydengankontrakberdurasisatutahun.ManajerZlateMoravce,MarekOndrejkaengganmenyebutkehadiranEgyhanyabagiandaristrategipemasaran.BacaJuga:EgyMaulanaDikontrak1Tahun,WitanLebihLama,BeginiHarapanSangAgenBukanrahasiaumumapabilapemainasalIndonesiadatang,klubakankebanjiraneksposure.Namun,Ondrejkamembantahitudanmenyebuttimnyabenar-benarmembutuhkansosokEgydiataslapangan.KamimengagumikreativitasdanvariasiseranganyangdimilikiEgy.Diajugamemilikikemampuanbagussaatduelsatulawansatu.BacaJuga:EfekEgyMaulanaVikri,PengikutFCViOnZlateMoravceLampauiPopulasiKotanyaDiahadiruntuksepakbola,pemasaranhanyabagiandaribonus,ujarOndrejkadilansirdarilamanresmiklub.Kendatidemikian,Ondrejkatakmembantahpemasaranyangbagusakanmemberikanefekpositifbagiklub.

IrjenFerdySambo.Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-EksKadivPropamPolriIrjenFerdySambomengutarakanmotivasidanniatnyadibalikkasuspembunuhanNofriansyahYoshuaHutabarataliasBrigadirJ.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});ApayangdilakukanFerdyitu,semata-matahanyainginmenjagadanmelindungimuruahkeluarga.PengakuanFerdyitutertuangdalamsuratpernyataanyangdibacakanpengacaranya,ArmanHaniskepadaawakmediadiJakarta,Kamis(11/8).BacaJuga:IrjenFerdySamboBikinSurat,DibacakanPengacaranya,SinggungSoalNiatNiatsayauntukmenjagadanmelindungimaruahsertakehormatankeluargayangsangatsayacintai,ujardia.Terlepasdariitu,alumnusAkpol1994itumenyampaikanpermintaanmaafkepadarekansejawatnyadiPolri,keluarga,danmasyarakatyangterdampakdaripolemikdalamkasuspembunuhanBrigadirJ.Secaratulusmemintamaafdanmemohonmaaf,kataArman.BacaJuga:AmarahFerdySamboMemuncakSetelahPutriCandrawathiMelaporSoalIniEksDirekturTindakPidanaUmumBareskrimitusadarpolemikdalamkasustewasnyaBrigadirJbermuaradariperbuatannyayangmemberikaninformasitidakbenar.Memberikaninfomasiyangtidakbenarsertamemicupolemik,ujarnya.MantanKadivPropamPolriIrjenFerdySambotersangkakasuspembunuhanberencanaterhadapBrigadirJ.Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-MotifpembunuhanterhadapBrigadirNofryansahYosuaHutabarataliasBrigadirJakhirnyaterkuak.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});DirekturTindakPidamaUmum(Dirtipidum)BareskrimPolriBrigjenAndiRianDjajadimenyebutmotifpembunuhanitukarenaIrjenFerdySambomerasaemosidanmarahkepadaBrigadirJ.Sebab,PutriCandrawathidilukaiharkatdanmartabatnyaolehBrigadirJ.BacaJuga:IrjenFerdySamboBikinSurat,DibacakanPengacaranya,SinggungSoalNiatFaktaituterungkapsetelahtimkhusus(timsus)memeriksaIrjenFerdySambosebagaitersangkadiMakoBrimob,KelapaDua,Depok,Kamis(11/8).DalamketerangannyatersangkaFS(FerdySambo,red)mengatakanbahwadirinyamenjadimarahdanemosisetelahmendapatlaporandariistrinyaPC(PutriCandrawathi,red)yangtelahmengalamitindakanyangmelukaiharkatdanmartabatkeluarga,kataBrigjenAndidiMakoBrimobKelapaDua,Kamis(11/8).TindakanyangdilakukanBrigadirJterhadapPutriCandrawathiituterjadidiMagelang.BacaJuga:AmarahFerdySamboMemuncakSetelahPutriCandrawathiMelaporSoalIniJenderalbintangsatuitumengatakanmengatakanketeranganFerdySambotersebuttelahdituangkandalamberitaacarapemeriksaan(BAP).ItupengakuantersangkadiBAP,ujaralumnusAkpol1991itu.PengacaraRazmanArifNasution.Foto:Romaida/JPNN.comjpnn.com,JAKARTA-PengacaraRazmanArifNasutionmenyindirHotmanParismelaluiakunnyadiInstagram.HalitusehubungandenganHotmanParisyangmemprediksikasuskematianBrigadirJsertamemberikanmasukanuntukBharadaE.RazmanNasutionlantasmenyindirapakahrivalnyaitusudahbergantiprofesilantaranmembuatprediksisepertiitu.BacaJuga:WendiCagurBanjirPujianGegaraRokAyuTingTingSobekIniorangsudahjadiperamalya?Atausudahmerangkapperamaldanpengacara?ujarRazmandikutipKamis(11/8).DiajustrumemintapengacaraBharadaEagarberhati-hatidenganucapanHotmanParis.SebabdiamendugaHotmanmemilikiniatlaindibaliksikapnyatersebut.BacaJuga:SorotiWajahHotmanParis,RazmanNasution:KeracunanObatAtauBisajadiiniupayadiauntukmencarisimpatipihakkeluargaBharadaEseolah-olahHotmanParisyangpalingpahamakanupayapembelaanhukumterhadapBharadaE,kataRazmanNasution.Sebelumnya,HotmanParisternyatasempatmemprediksisoaladanyatersangkabarudalamkasuskematianBrigadirJ.DahlanIskan(Disway).Foto:Ricardo/JPNN.comjpnn.com-MEDIAinilahyangharusdicatatsebagaipembukaperistiwaDurenTiga.Mediamainstream.Kalautidak,bisajadiperistiwaituterkuburmungkinuntukselama-lamanya.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601113788040-0);});MediaituadadiJambi.Wartawanitusebenarnyatelattahu:adapolisi,asalJambi,yangmatitertembak.Sudahduaharisebelumnya.Wajartelat.Rumahpolisiitudipedalaman.Sangkorbanjugadikuburdipedalamanitu.Kurangbisamenarikperhatianseketika.BacaJuga:KepungCendolSiwartawanlantaskePoldaJambi.HumasPoldatidaktahu.IamemintaSiwartawankeKabidPropam.MungkinbidangPropamyangtahu.InikanmenyangkutanggotaPolri.Namun,PropamPoldaJambijugatidaktahu.Tidakbisamenjawab.MakaPropamJambimenanyakanitukePropamMabesPolri.FerdySambopunambilkesimpulan:berartiperistiwaDurenTigasudahdiketahuimedia.Tidakbisalagiditutupi.Harusdisiapkanjawabanyangtepat.Yangbisamembantumenyusunjawabanituharusorangyangmemahamimedia.BacaJuga:LabirinPolkamIrjenFerdySambotidaksulitmencariorangyangpunyakualifikasidekatdenganmedia.Iajugasosokyangaman.Tepercaya.IapenasihatahliKapolri,bidangkomunikasipublik.MakaJenderalSambomeneleponSangpenasihatmedia:FahmiAlamsyah.

SejumlahpersonelBrimobbersenjatalengkapsaatberjagadirumahpribadiIrjenFerdySambo,JalanSagulingIII,KomplekPertambangan,DurenTiga,JakartaSelatan,Selasa(9/8/2022).Foto/dok:Ricardo/JPNNjpnn.com,JAKARTA-DahlanIskanmengungkapsosokyangdihubungiIrjenFerdySambosetelahkematianYosuaHutabarataliasBrigadirJdiketahuiwartawanmediamainstream.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});CeritayangdiperolehkolumniskondangitudituangkandalamtulisanDiswayedisiJumat(12/8).DalamtulisanituDahlanmenjelaskanawalkematianBrigadirJterungkapkepubliksetelahterciumolehwartawanmediamainstreamdiJambi.BacaJuga:InikahSebabMediaTelatTahusoalInsidendiRumahFerdySambo?Kalautidak,bisajadiperistiwaituterkuburmungkinuntukselama-lamanya,tulisDahlandalamtulisanberjudulBintangWanita.Konon,wartawanyangmengetahuikematianBrigadirJmengonfirmasinyakepadahumasPoldaJambi.Namun,karenapolisididaerahitutidakmengetahuikejadiannya,pihakPoldaJambipunbertanyakeMabesPolri.BacaJuga:UcapanMaluPutriSambodanKonten17TahunkeAtas,HmmmSingkatcerita,FerdySambomengambilkesimpulan:berartiperistiwaDurenTigasudahdiketahuimedia.Tidakbisalagiditutupi,sambungtulisanDahlan.SkuadVietnamU-16saatberlagadiPialaAFFU-162022.Foto:Twitter/AFFPressejpnn.com,YOGYAKARTA-PelatihVietnamNguyenQuocTuanungkapketakutantersebarnyasaatjumpaTimnasU-16IndonesiadifinalPialaAFFU-162022.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601051053163-0);});Nguyensedikitkhawatirdenganterorsuportertuanrumah.Bukantanpaalasan,sangjurutaktikmenjadisaksisaatkipercadanganVietnamdilemparibotololehsuporter.BacaJuga:FinalPialaAFFU-162022:VietnamDiterpaKabarBurukJelangJumpaIndonesiaDukungansuporter(diIndonesia,red)terkadangterlaluliar.Ituyangmembuatkamikesulitan,ucapNguyen.Kendatidemikian,Nguyenmengakutimnyasudahsiapdengansegalatekanandanterordarisuporter.Sayasudahsiapkanmentalpemainagarmerekapercayadiri,imbuhdia.BacaJuga:BukanTrikPemasaran,TernyataIniAlasanFCViONZlateMoravceBoyongEgyMaulanaBimaSaktidisisilain,memintasuportermemberikandukungankepadaTimnasU-16Indonesiasecaradewasa.Dukungkamisecarafairdansportif.Kitaharusrespekdengansemualawan,ucapBima.

DirekturTindakPidanaUmumBareskrimPolriBrigjenAndiRianDjajadi(berjaketcokelat).Foto:FransiskusAPratama/JPNN.comjpnn.com,JAKARTA-BareskrimPolrimenyebutBhayangkaraDuaRichardEliezeratauBharadaEtelahmencabutsuratkuasaterhadapkeduakuasahukumnya,DeolipaYumaradanBurhanuddin.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});DirekturTindakPidanaUmum(Dirtipidum)BareskrimPolriBrigjenAndiRianmengatakanpencabutankuasatersebutdilakukanBharadaEpadaRabu(10/8).Pengacarabukanmengundurkandiri,tetapikuasasipengacaradicabutolehsipemberikuasa,kataAndisaatdikonfirmasi,Jumat(12/8).BacaJuga:IniSosokKM,1dari4TersangkaKasusPembunuhanBerencanaBrigadirJ,TernyataJenderalbintangsatuitumengatakanDeolipadanBurhanuddinmerupakansenjatinyapengacarayangditunjukpenyidikgunamendampingisaatpemeriksaan.MerekapengacaraditunjukolehpenyidikuntukmendampingiBharadaREdalampemeriksaanpasca-pengacaraawalyangditunjukolehtersangkaFSuntukBharadaREmengundurkandiri,ujarAndi.BrigjenAndimenyebutBharadaEtelahmenunjukpengacaralainsebagaipenggantiDeolipadkk.BacaJuga:FerdySamboTersangkaKasusPembunuhanBrigadirJ,2PerwiraTinggiIkutTerseretKendatidemikian,Andibelummemerincisiapapenggantinya.Sebelumnya,beredarsuratyangmenyebutkanBharadaEmencabutkuasanyaterhadapDeolipadanBurhanuddin.IrjenFerdySamboditetapkansebagaitersangkapembunuhanBrigadirJatauNofriansyahYosuaHutabarat.Foto:Ricardo/JPNNjpnn.com,JAKARTA-IrjenFerdySambomenulissebuahsuratdariMakoBrimob.IsisurattersebutdibacakanpengacaramantanKepalaDivisiProfesidanPengamanan(KadivPropam)Polri.FerdySambomengakupolemikkasuskematianajudannya,BrigadirJitubermuaradariperbuatannyayangmemberikaninformasitidakbenar.BacaJuga:MengapaFerdySamboHubungiSosokIniSetelahKematianYosuaTakBisaDitutupi?Memberikaninfomasiyangtidakbenarsertamemicupolemik,katapengacaraFerdySambo,ArmanHanis.FerdySambomemintamaafkepadaseluruhpihakyangterdampakpolemikkasuspembunuhanBrigadirJ.Namundemikian,IrjenFerdySambomenunjukkansikapkesatriadenganberjanjiakanpatuhdanmengikutisetiapproseshukumyangsaatinisedangberjalanataunantidipengadilan.BacaJuga:DikaitkandenganFerdySambodalamKematianBrigadirJ,IrjenFadilBertemuNyomanAkansayapertanggungjawabkan,ungkapalumnusAkpol1994itu.Selainitu,dikatakanArmanHanis,eksDirekturTindakPidanaUmumBareskrimitumenyampaikanpermintaanmaaf.

KetuaKomnasHAMRIAhmadTaufanDamanik.Foto:Ricardojpnn.com,JAKARTA-KomisiNasionalHakAsasiManusia(KomnasHAM)telahmemeriksamantanKadivPropamIrjenFerdySambodiMakoBrimob,Depok,Jumat(12/8)sore.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});PemeriksaantersebutdalamkapasitasSambosebagaitersangkakasuspenembakanyangmenewaskanBrigadirYosuaHutabaratatauJ.KetuaKomnasHAMAhmadTaufanDamanikmengatakanpemeriksaantersebutdilakukandalamsaturuangankhususyangberisidirinya,IrjenSambo,KomisionerKomnasHAMBekaUlungHapsara,danChoirulAnam.BacaJuga:IrjenFerdySamboMengakuiPalingBertanggungJawabatasKematianBrigadirJMenurutTaufan,dalampermintaanketeranganataupemeriksaantersebut,adabeberapahalyangdiperoleh.PertamaadalahpengakuansaudaraFSbahwadiaaktorutamadariperistiwaini.FSmengakuisejakawaldialahyangmelakukanlangkah-langkahuntukmerekayasa,mengubah,ataumendisinformasibeberapahal,ucapTaufan.AkibatrekayasaIrjenSambotersebut,skenarioawalnyaterbanguninsidentembakmenembakyangmelibatkanBrigadirJdanBharadaE.BacaJuga:WahaiKapolri,IniSikapPakJokowisoalMisteriMotifPembunuhanBrigadirJNamunkemudiandiakuinyaituhasilrancanganFSsendiridanmengakuibahwadiabersalahdalamtindakannya,ucapDamanikPatiYanmaitupunmenyampaikanpermintaanmaafkepadasemuapihaktermasukKomnasHAMdanmasyarakatIndonesiaatastindakannya.PTJasaRaharja.Foto:dokJasaRaharjajpnn.com,SURABAYA-PTJasaRaharjasuksesmenggelarRoadSafetyRangerKidsbertajukLindungiAnakdalamPerjalanannyadiDyandraConventionCenter,Surabaya,JawaTimurpadaSabtu(6/8.)googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Kegiatanitudiikuti400pesertayangterdiridarisiswa-siswiSekolahDasar(SD)diwilayahKotaSurabaya.DirekturHubunganKelembagaanPTJasaRaharjaMunadiHerlambangmengatakan,kegiatantersebutbertujuanuntukmenanamkankedisiplinanberlalulintaskepadaanak-anak.BacaJuga:AdabTiduryangDisarankanDalamAjaranIslamParaorangtua,biasanyalebihpatuhkalaudiingatkanolehanaknyasendiridaripadasamaoranglain,ujarMunadidiselakegiatantersebut.Munadimenegaskankedisiplinanberlalulintassangatpentinguntukditanamkansejakdini.Dengandemikian,diharapkanakanterbentukgenerasimudayangberkeselamatandanmenjadipeloporkeselamatanberlalulintasdijalanraya.BacaJuga:MenteriESDMBakalTertibkanRKABBuramTambangTimahPenanamankedisiplinanberlalulintasbagiusiadini,akanlebihefektifjikadiberikansemenarikmungkin.Olehsebabitu,agendaRoadSafetyRangerKids,jugadigelardengankonsepfun.Disinianak-anakbisamenikmatisuasanatamanlalulintassambilmempelajariaturan-aturanberkendara,jugaaturanpejalankakidijalanmelaluipos-pospermainan.Sehinggamerekatidakhanyaterhibur,namunjugamendapatpembelajaranpentingdalamberlalulintas,paparMunadi.

Waspadacuacabesok,Sabtu.IlustrasiFoto:Ricardo/JPNN.comjpnn.com,JAKARTA-BadanMeteorologi,Klimatologi,danGeofisika(BMKG)memprediksicuacacerahhinggahujandisertaipetirterjadidisejumlahkotabesarIndonesia,Sabtu(13/8)besok.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});PrakirawanBMKGIdhanAbubakarmengatakancuacabesokdiwilayahSumatra,seperti,Pekanbaru,TanjungPinang,Pangkalpinang,danPalembangdiprediksihujanringan.CuacadiJambidanBandarLampungdiprediksihujandisertaipetirsertaPadangberkabut.BacaJuga:BMKGBeberkanDataCuacaTujuhHariMendatangdiNTBSelanjutnya,cuacadiBengkuludanMedandiprakirakanberawansertaBandaAcehcerah.AdapununtukwilayahJawa,sepertidiSerang,DKIJakarta,Bandung,danSurabayadiprakirakancuacanyahujanringan.CuacadiSemarangdiprediksihujansedangsertaYogyakartaberawan.BacaJuga:RaisaAkanMencetakSejarahdiGBKCuacabesokdiwilayahKalimantan,sepertidiTanjungSelordanSamarindadiprediksihujanringansertaPalangkarayahujansedang,kataIdhan,Jumat(12/8).CuacadiPontianakdanBanjarmasindiprakirakanhujandisertaipetir,sambungIdhan.TimnasU-16IndonesiaberhasilmenjuaraiPIalaAFFU-162022setelahmengalahakanVietnam1-0.Foto:Antarajpnn.com,YOGYAKARTA-TimnasU-16IndonesiasuksesmenjuaraiPialaAFFU-162022.HasilitudidapatsetelahSkuadGarudaAsiamenang1-0melawanVietnampadalagafinaldiStadionMaguwoharjo,Sleman,Yogyakarta,Jumat(12/8)malam.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601051053163-0);});GolsematawayangIndonesiadilagainidihasilkanolehKafiaturRizky.Tampildidepan30ribupenonton,TimnasU-16Indonesialangsungtampilagresifsejakmenitawal.BacaJuga:PenerimaIBLAwards2022:NSHdanPrawiraBandungMendominasi,WestBanditsCuriPerhatianPeluangpertamabagiIndonesiadatangpadamenitke-4.Sepakanbebasdidapatkan,tetapibelumbisamenjadigolkarenamampudihalaupemainVietnam.SetelahituIndonesiaterusmenekan,sementaraVietnambermainlebihsabarsambilmenunggukesempatanseranganbalik.PermainantempocepatyangcobadijalankanolehIndonesiabeberapakalisempatterganggukarenapelanggaran-pelanggarankecilyangdilakukanolehVietnam.BacaJuga:Blak-blakan!MarcusRashfordMasihBetahdiMU,PSGBisaGigitJariSepakanontargetpertamaIndonesiakegawangVietnambaruterciptapadamenitke-12.Sayang,tembakanFigomasihlemahdanbisadiamankankiperVietnam,PamhDinHaiMenitke-14,Vietnammembalasviasetpiecesepakanbebas.Beruntung,sundulanpemainVietnamyanglurusmengarahkegawang,bisaditepisolehAndrikaFathir.KapolriJenderalListyoSigitPrabowosebutjumlahpolisimelanggarkodeetikdikasusBrigadirJ.Foto:Ricardo/JPNNjpnn.com,JAKARTA-AnggotaKomisiIIIDPRRIArsulSanimenilaitepatkeputusanKapolriJenderalListyoSigitPrabowountukmembubarkanSatgassusMerahPutih.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Sebab,timitubanyakbekerjamelampauibatasdanmengambiltugasdarisatuankerja(Satker)PolrisepertiyangberadadiBareskrim.Jadi,memangitutelahcenderungmenjadipermanen,sehinggaadaoverlappingdengansatuankerjaPolrilainnya,kataArsulmelaluilayananpesan,Jumat(12/8).BacaJuga:KapolriBubarkanSatgassusPolriSetelahTetapkanFerdySamboTersangkaPembunuhBrigadirJKedepan,katalegislatorFraksiPPPitu,SatgassusMerahPutihsebaiknyabersifatadhocdanuntukjangkapendekatautertentusaja.Kemudianditetapkandenganjelassertadengantugasspesifikterbatas.TakubahmisalnyasatgasdslamrangkaoperasiTinombalaatauKetupatLebaran,ujarWakilKetuaMPRRIitu.SatgassusMerahPutihdiketahuipertamakalidibentukpada2019olehKapolrisaatituJenderalTitoKarnavian.BacaJuga:IrjenFerdySamboTersangka,MQodari:KepercayaanPublikTerhadapPolriMakinTinggiPembentukannyamelaluiSuratPerintahNomorSprin/681/III/HUK.6.6/2019tertanggal6Maret2019.Satggasusmemilikibeberapafungsi,diantaranya,melakukanpenyelidikandanpenyidikantindakpidanayangmenjadiatensipimpinandiwilayahIndonesiadanluarnegeri.BhayangkaraDuaRichardEliezeratauBharadaE.Foto:Ricardo/JPNNjpnn.com,JAKARTA-LembagaPerlindunganSaksidanKorban(LPSK)memutuskanuntukmemberikanperlindungandaruratkepadaBharadaRichardEliezerPudihangLumiuatauBharadaE.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});PemberianperlindungandaruratdiputuskansetelahLPSKbertemudenganBharadaEdiBareskrimPolri.SoreinipimpinanmemutuskanuntukmemberikanperlindungandaruratkepadaBharadaE(RichardEliezer),kataKetuaLPSKHastoAtmojoSuroyosaatdihubungiwartawan,Jumat(12/8).BacaJuga:IrjenFerdySamboMengakuiPalingBertanggungJawabatasKematianBrigadirJDiamengatakanperlindungandaruratdiberikansembarimenungguhasilRapatParipurnaLSPKuntukmenentukanpermohonanjusticecollaboratordariBharadaE.Jadi,kamimemberikanperlindungandarurat.Kalauadaapa-apa,BharadaEsudahmendapatkanhakyangsamadenganparaterlindunglain,tegasnya.HastomenyebutkanperlindungandaruratituakanberlakuhinggaPapatParipurnaLPSKyangakandigelardalamwaktudekat.BacaJuga:IrjenFerdySamboTersangka,KapolriBubarkanSatggasus,HabibAboeMeresponsBeginiBharadaETunjukKuasaHukumBaru,NihOrangnyaPerlindungandaruratinidiberikansambilmenunggurapatparipurnaterdekatuntukdiputuskansecaraformal,jelasnya.Sebelumnya,BrigadirJ,RichardEliezeraliasBharadaEtelahmengajukandirisebagaijusticecollaboratorkeLPSKterkaitkasuspenembakandirumahdinasIrjenFerdySambo,DurenTiga,JakartaSelatan.(mcr8/jpnn)Simak!VideoPilihanRedaksi:

IrjenFerdySambo.Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-PengacaraIrjenFerdySambo,IrwanIrawanmeragukanpemberianamplopkepadapetugasLembagaPerlindunganSaksidanKorban(LPSK)diKantorDivisiPropamPolri.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});DiamengeklaimperistiwayangawalnyadiungkapMenkoPolhukamMahfudMDitutidakterjadi.Samasekalitidakadaperistiwaitu,kataIrwanIrawansaatdihubungiwartawan,Jumat(12/8).BacaJuga:SeusaiJumpaFerdySambo,PetugasLPSKDisodori2AmplopuntukBerdua,ehTipisDiapunmengatakanbilayangdiceritakanitubenar-benarterjadi,makaharusdisebutsiapayangmemberikan.Harusdisebutkansiapayangmemberikan,lanjutIrwan.Selainmengungkapsiapayangmemberikanitu,LPSKjugaharusmenjelaskanapaisiamploptersebut.BacaJuga:MengapaFerdySamboHubungiSosokIniSetelahKematianYosuaTakBisaDitutupi?Olehkarenaitu,pihaknyameragukanpemberianamplopyangdisebuttitipankliennyauntukpetugasLPSKitu.Diragukan,karenaharusmenyebutkantujuannya,pemberianapa,dansiapayangmemberikan,tuturnya.EksKuasahukumBharadaE,DeolipaYumara(kiri)memintauangfeeRp15triliunkepadaBareskrimPolri.Foto:FransiskusAdryantoPratama/JPNN.comjpnn.com,JAKARTA-EkskuasahukumBharadaE,DeolipaYumaramengancambakalmenggugatPresidenJokoWidodo(Jokowi)hinggaKapolriJenderalListyoSigitPrabowojikapermintaannyatidakdikabulkan.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});DeolipamemintafeeRp15triliunkepadanegaraatasjasanyamenjadipengacaraBharadaE.AdapunDeolipaYumarasebelumnyaditunjukBareskrimPolriuntukmenjadipengacaraBharadaE.BacaJuga:JadiKuasaHukumBharadaE,RonnyTalapessyBilangBegini,TegasNamun,kiniDeolipasudahtakjadipengacaraBharadaE.AjudanIrjenFerdySamboitumencabutsuratkuasapenunjukanDeolipasebagaikuasahukum.Ya,kan,kita(saya)ditunjuknegara,negara,kan,kaya,masakitamintaRp15triliunenggakada.Yakalauenggakadakitagugat,catatsaja,kataDeolipakepadawartawan,Jumat(12/8).BacaJuga:BharadaETunjukKuasaHukumBaru,NihOrangnyaDeolipabakalmenggugatsecaraperdatakePengadilanTataUsahaNegara(PTUN)jikapermintaannyatersebuttakdikabulkannegara.Kapolrikita(saya)gugat,semuakitagugat.Presiden,menteri,kapolri,wakapolri,semuanyakitagugat,ujarpriaberambutgondrongitu.

TimnasU-16Indonesia(jerseiputih-hijau)saatmelawanVietnam(jerseimerah)difinalPialaAFFU-162022.Foto:ASEANFootball.jpnn.com,YOGYAKARTA-SejumlahfaktamencengangkanterciptaseusaiTimnasU-16IndonesiamenjuaraiPIalaAFFU-162022.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601051053163-0);});SkuadberjulukGarudaAsiaitunaikpodiumtertinggisetelahmemukulVietnam1-0padalagayangdihelatdiStadionMaguwoharjo,Sleman,Jumat(12/8/2922).GolsematawayangTimnasU-16IndonesiadibukukanolehKafiaturRizky(45+2).BacaJuga:MenporaAmaliBanggaTimnasU-16IndonesiaJuaraPialaAFF,JadiHadiahHUTRIDibalikkemenanganTimnasU-16terdapatsejumlahfaktamencengangkanyangtercipta.SimakulasanJPNN.comberikutini.1.GelarKeduaInimerupakangelarPialaAFFU-16keduabagiIndonesia.Sebelumnya,timMerahPutihjugamenjuaraiturnamenkelompokumurantarnegaraAsiaTenggaraitupadaedisi2018.Saatitu,IndonesiamengalahkanThailanddipartaipuncakmelaluidramaadupenalti.BacaJuga:LuarBiasa!KaptenIndonesiaDinobatkanSebagaiPemainTerbaikPialaAFFU-162022SelainmerebutduagelarPialaAFFU-16,Indonesiajugasekalimenjadirunnerupdanduakalimenempatiperingkatketigapadakejuaranyangdigelarsejak20tahunsilamini.2.CumaKebobolanDuaGolIndonesiacumakebobolanduagolsepanjangkeikusertaannyadiPialaAFFU-162022.KetumKNPIHarisPertama.Foto:HumasKNPIjpnn.com,JAKARTA-KetuaUmumDPPKNPIHarisPertamamenyorotisikapKetuaHarianKompolnasIrjen(Purn)BennyMamotoyangterkesanmendukungskenariopembunuhanBrigadirJolehFerdySamboCs.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Sebelumkasusiniterungkap,ujardia,BennyMamotopernahmenyatakanbahwatidakadakejanggalandalamkasusini.KomentarBennyitumerujukpadarilisyangdikeluarkanolehPolresMetroJakartaSelatansecararesmi.StatemenBennyMamotoituhanyadalihuntukmenutupidiridariskenarioyangdibuatolehFerdySambo.SayaharapTimsusMabesPolripimpinanWakapolrisegeraperiksaketerlibatanBenny,kataHaris.BacaJuga:IrjenFerdySamboMengakuiPalingBertanggungJawabatasKematianBrigadirJLanjutHaris,bisasajadarihasilpemeriksaanBennybisamendapatkaninformasiyangakurat.Apalagi,dugaanketerlibatanBennydalammenyusunskenariotesebutsehinggaperludijawabmelaluiproseshukum.KompolnassebagailembagayangdiberitugasuntukmengawasikinerjaPolri,kokdidugatelahikutmengembangkannarasiawalterkaitkematianBrigadirYosua,jelasHaris.SetelahFSjaditersangkadiketahuisemuaberitaterkaitpolisitembakpolisiadalahhoaksaliasnarasipalsu.BacaJuga:FerdySamboJanjikanRp1MiliaruntukBharadaE,UangTutupMulutAlibisajaitu,kejadianiniharusnyajadireferensiTimsusMabesPolriuntuksegeraperiksaBennyMamoto.LalucekjugarekeningdanHPnya,karenadugaandimasyarakatbahwapakBennyMamototerlibatdalamskenariotembakmenembak,kataHaris.SelainBenny,HarisjugamemintaKomisionerKomnasHAMMChoirulAnamyangtelahmembeladenganmempertayakantujuanpolisigeledahrumahFSyangdilakukanolehaparatkepolisian.

DuelantaraTimnasU-16Indonesia(jerseiputih-hijau)vsVietnam(jerseimerah)difinalPialaAFFU-162022.Foto:ASEANFootball.jpnn.com,YOGYAKARTA-PelatihVietnamNguyenQuocTuansedikitterhiburmeskitimnyataklukdariTimnasU-16IndonesiadifinalPialaAFFU-162022.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601051053163-0);});TheYoungGoldenStarharuspuasmenjadirunnerupsetelahmenyerah0-1dariIndonesiapadalagayangdihelatdiStadionMaguwoharjo,Sleman,Jumat(12/8/2022)malam.Namun,kekecewaanNguyensedikitterobatiketikamelihatpenggawaTimnasU-16melakukanpenghormatan(guardofhonoured)kepadaanakasuhnya.BacaJuga:3FaktaMencengangkanSetelahTimnasU-16IndonesiaJuaraPialaAFFU-162022ItusikapyangsangatbaikdariIndonesia.Tindakanmerekamengurangikekecewaankamiakibatkalahdipartaipuncak,ucapNguyendilansirAntara.Guardofhonouredsejatinyalumrahdilakukanuntukmemberikanpenghargaankepadatimyangjuara.Namun,kaliinisedikitterasaberbedakarenaIndonesiaselakukampiunPialaAFFU-162022denganbesarhatimelakukanguardofhonouredkepadaVietnam.BacaJuga:MenporaAmaliBanggaTimnasU-16IndonesiaJuaraPialaAFF,JadiHadiahHUTRITimnasU-16IndonesiasendirimenguncigelarPialaAFFU-16setelahmenang1-0atasVietnam.GolsematawayangtimberjulukGarudaAsiaitudibukukanolehKafiaturRizkypadamenit45+2.(antara/jpnn)KinerjacemerlangBRIberhasilmeraihpenghargaandiajang12thAnnualTreasury&FXAwards2022yangdiselenggarakanolehAlphaSouthEastAsia.Foto:BankBRIjpnn.com,JAKARTA-CapaianpositifPTBankRakyatIndonesia(Persero)TbkatauBRIterusmendapatkanpengakuan.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601039399667-0);});KinerjacemerlangBRIberhasilmeraihpenghargaandiajang12thAnnualTreasuryFXAwards2022yangdiselenggarakanolehAlphaSouthEastAsia.Tigapenghargaantersebut,yakniBestFXBankforStructuredProducts:Commodities,Credit,Equity,FXandMulti-Asset,BestFXBankforMoneyMarketProducts,danBestFXBankforRetailClients.BacaJuga:GenjotPemahamanDigitalisasiUMKM,BRIGelarPestaRakyatSimpedesdiKarawangSEVPTreasurydanGlobalServicesBRIAchmadRoyadimenyebutkanperseroanmengapresiasipenghargaantersebutsebabakanmenjadisemangatuntukterusmemberikankontribusiterbaik.InimembuktikanbahwakinerjaBRImendapatpengakuandankredibilitasinternasionaldimatashareholder.Penghargaan-penghargaanyangdiberikanakanmenjadimotivasibagikamiuntukmendorongkinerjaterbaikBRI,ujarRoyadidalamketerangannyadiJakarta,Sabtu(13/8).AchmadmenjelaskanselamainibisnistreasuryBRIporsinyapunterusditingkatkansetiaptahununtukikutmenopangtotalfeedanpendapatanoperasional.BacaJuga:DirutBRIBuka-bukaansoal6StrategiMempertahankanKinerja,TetapKinclongDiamemerincipada2018,sumbangsihtreasuryBRInaikmenjadiRp1,51triliundengantotalfeedanpendapatanoperasionallainnyayangmencapaiRp22,7triliun.Pada2019nilainyamencapaiRp1,69triliundaritotalRp27,5triliun.

Iklan Bawah Artikel